SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001954 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001954
Domain Number 1 Region: 9-178
Classification Level Classification E-value
Superfamily E set domains 8.86e-80
Family Arrestin/Vps26-like 0.000000084
Further Details:      
 
Domain Number 2 Region: 180-387
Classification Level Classification E-value
Superfamily E set domains 2.94e-68
Family Arrestin/Vps26-like 0.0000000451
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001954   Gene: ENSTNIG00000011222   Transcript: ENSTNIT00000002401
Sequence length 397
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:92419904:92423354:1 gene:ENSTNIG00000011222 transcript:ENSTNIT00000002401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEKPTELQHQVFKKASPNGKLTVYLGKRDFVDRVDQVESVDGVVLIDPEYLKERKVFVTL
TCAFRYGREDLDVLGLTFRKDLFVANSQMFPSPPDLEKSLTRLQERLMKKLGEHAHPFTF
KIPLNLPCSVTLQPGPEDTGKACGVDFEVKAFCAENPEEKIHKRNSVRLVIRKVQYAPEK
PGPQPTAETSRQFLMSDKLLHLEASLDKQIYYHGEPISVNVHVTNNTNKTVKKMKVSVRQ
LADICLFSTAQYKCTVAMEESDDVVPPSSTFCKVFTVTPFLANNRDKRGLALDGKLKHED
TNLASSTLLGEGASKEILGIIVSYKVKVKLVVSRLLGDLTMSDVSIELPFTLMHPKPLNF
HLLLLSDDDIIFEDFARQRLTGVVDEKQEEEEAADSS
Download sequence
Identical sequences H3C138
ENSTNIP00000001954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]