SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001970 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001970
Domain Number 1 Region: 386-584
Classification Level Classification E-value
Superfamily ADP-ribosylation 6.81e-29
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001970   Gene: ENSTNIG00000006353   Transcript: ENSTNIT00000002985
Sequence length 613
Comment pep:known_by_projection chromosome:TETRAODON8:5:1504029:1514051:-1 gene:ENSTNIG00000006353 transcript:ENSTNIT00000002985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDIKGQCWTDEESDGENESEQFLYGIQGSCAADLYRHPQLDADIEAVKDIYTDSAVSVRE
YGIIDDVDIDLHINIGFLDEEVATAWKVIRTEPIIVRLRFSLSQYLDGPEPSVEVFQPSN
KEGFSLGLQLKKILSTFTSQQWKHLSNEFLKAQQEKRHSWFKAGGTIKKFRAGLSIFSPI
PKSPSLPLIQDTVLKGKLSVPELRVTRLMNRSISCTMKNPKGELFSYPPNSQAGGHCKNI
PTLEYGFLVQIMKYSEQRIPTLNEYCVVCDEQHVFQNGSMLKPAVCTRELCVFSFYTLGV
MSGAAEEVATGAEVVDLLVAMCRAALESPRKSIIFEPYPSVVDPNDPKTLAFNPKKKNYE
RLQKALDSVMSIREMTQGSYLEIKKQMDKLDPLAHPLLQWIISSNRSHIVKLPLSRQLKF
MHTSHQFLLLSSPPAKEARFRTAKKLYGSTFAFHGSHIENWHSVLRNGLVNASYTKLQLH
GAAYGKGIYLSPISSISFGYSGMGKGQHRMPTKDELVQRYNRMNTIPQSRPVQSRFLQSR
NLNCIALCEETVITSKDLQKHGNIWVCPVSDHVCTRFFFVYEDGQVGDANINTQEPKVQK
EIMRVIGTQIYSS
Download sequence
Identical sequences H3C154
ENSTNIP00000001970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]