SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001972 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001972
Domain Number 1 Region: 176-523
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.58e-94
Family Ankyrin repeat 0.00000294
Further Details:      
 
Domain Number 2 Region: 642-974
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.39e-63
Family Ankyrin repeat 0.00000954
Further Details:      
 
Domain Number 3 Region: 9-227
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.17e-62
Family Ankyrin repeat 0.0000629
Further Details:      
 
Domain Number 4 Region: 474-634
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.24e-30
Family Ankyrin repeat 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001972   Gene: ENSTNIG00000001878   Transcript: ENSTNIT00000000115
Sequence length 989
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:105287275:105297039:-1 gene:ENSTNIG00000001878 transcript:ENSTNIT00000000115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMFFFYSAQPPLIQAIFSGDPEGDTLLWCNPDDVSVKDAEKRTPLHAAAFLGDAEIAELL
ILSGARVNAKDSMWLTPLHRAVASRSEEAVRVLIHHSADVNARDKNWQTPLHVAAANNAL
RCAEVIIPLLSSVNVSDRGGRTALHHAALNGHTEMVNLLLSKGANINAFDKKDGRPLHWA
AFMGHLNVVRLLVTQGAEVSCKDKRGYTPLHTAASSGQIAVIKHLLNLAVEIDESNAFGN
TALHLACFNGQDMVASELIDCGANVSQPNNKGFTPLHFAAASTHGAPCFEFLVNNGADVN
VQSRDGKSPLHMTAVHGRFTRSQTLIQNGGEIDSVDKDGNTPLHIAARYGHELLINTLIT
SGADCTRRGVHGMFPLHLAALNAHSECCRKLLSSGFQIDTPDTLGRTCLHAAAAGGNVEC
VKLLLSSGGDHSRTDNCGRTPLHYAAASRHYQCLETLVACGTAINATDQWGRSALHYAAA
SDLDRRCLEFLLQSGATASLEDKQGYRPIHYAAAYGHKRCLELVRTRALLDRDHSHPNNP
EYLDARSPLHLAAYHGHAQALEVLLQGETDVDQRDEAGRTSLALAALRGHIECVHTLLSQ
GASPHAADSQHGRTPVHLAVMNGHTSCVRLLLDDSDGADLTDAADSQGQTPLMLAVVGGH
VDAVSLLLEREASVNVSNKHGFTALHLGLLFGQEECIQCLLEQEASVLLGDSQGRTAIHL
AAARGHASWLSELLNIACAEASSLPVLRDLGGYTPLHWACYYGHEGCVEVLLEQKGCRCI
DGNPFTPLHCAVGNNHEPCASLLLEAMGSDIVGCRDAKGRTPLHAAAFAGHVDCIHLLLS
HDAPVDAVDQSGFTPLMMAAEKGRDGALEVLLTSSSANLGLTDKDGNTALHLACSSGKES
CVMLILDRLTDGALLNTTNAALQTPLHLADRSGLKRAVEELLSRGASAQRADENGRSPVW
ALAGAPSREVADCLATMMPFCYPCSSRPP
Download sequence
Identical sequences H3C156
ENSTNIP00000001972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]