SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001977 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001977
Domain Number 1 Region: 5-472
Classification Level Classification E-value
Superfamily Sema domain 4.84e-161
Family Sema domain 0.00000000275
Further Details:      
 
Domain Number 2 Region: 474-522
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000981
Family Plexin repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001977   Gene: ENSTNIG00000019240   Transcript: ENSTNIT00000003504
Sequence length 794
Comment pep:known_by_projection chromosome:TETRAODON8:13:2825941:2832573:1 gene:ENSTNIG00000019240 transcript:ENSTNIT00000003504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKERTTKRFSASGVVNFTTLHLSEEDKMLYVGAREVLFALNLSDISQVTLQRNVTWKTPD
KKREECSFKGKDLQKDCFNYIKILLRVNSTHLYVCGTYAFSPTCAYIKTANFSLVKNDAG
EVVTEDGRSRCPFNPEYKSTAIIADGELYAGTVSNFQGNEPIIYKTLSQGTSLKTENSLN
WLQDPAFVGSAYIQESLPKGNEVGDDDKIYFFFSEVGKEFDFFDNTIVSRIARVCKGDLG
GERVLQKKWTTFLKAQLLCSLPDDGFPFNIIQDMFVLTPSPEDWKSTVFYGVFTSQWYKG
GSESSAVCSFTMDQVEQAFTGRYREVNRETQQWYTYNHPVPEPRPGMCITNEARKHGVSS
SLHMPDKVLNFVKDRFLMDSVIRSQPLLLKRNARYTQIAVHRVQTANKVYHVLFIGTDDG
RLHKAININKKMHIIEEMVLFRNSQPVQHIELDTEKGQLYVSSFSELVEVPVANCTNYQS
CGECILSRDPYCAWNGRQCVDIRKYPNKAWHQSIDEADMSSVCSVVLNPRFAKSPSLRMP
ACQVIIIPANTFRVLPCKLRSNLAVRKWEFSKAAGHFHYPSREGGLVVVAQVDRQENYQC
WSVEEGFRQLLANYCVRGEARQESTTFTGRSRMPPISQEEFIILPGESRSPHMNTKTYWN
ELLVVCALLAFSLVVFSLFVVYRNRSHMKSVLKEGECPAMQQKKPRTAGKPVENLPLNGN
AVTASVSDHKGYQTLNDNYICSTPPQECSSPDNSKSFSESEKRPLNLKESHVEISATGPR
PRVRLGSMIKDSIV
Download sequence
Identical sequences H3C161
ENSTNIP00000001977 ENSTNIP00000001977 99883.ENSTNIP00000001977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]