SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001983 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001983
Domain Number 1 Region: 113-218
Classification Level Classification E-value
Superfamily Second domain of FERM 7.33e-38
Family Second domain of FERM 0.0000028
Further Details:      
 
Domain Number 2 Region: 217-357
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-38
Family Third domain of FERM 0.0000111
Further Details:      
 
Domain Number 3 Region: 35-112
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.47e-24
Family First domain of FERM 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001983   Gene: ENSTNIG00000007346   Transcript: ENSTNIT00000002780
Sequence length 803
Comment pep:known_by_projection chromosome:TETRAODON8:11:10442452:10459451:1 gene:ENSTNIG00000007346 transcript:ENSTNIT00000002780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEHREADDMSEKTSSNKNLKSPQKGSKRLKTTPFKVTLLDAAVFEGETEKHSKGQTLMDM
VCGHLNLLEKDYFGLTFADADTQKNWLDPSKEIKKQMRSSQWHFAFAVKFYPPDPSQLTE
DITRYYLCLQLRDDILSGRLPCSFVTHALLGSYTVQAELGDYDHDEHGVDYVSDFRFAPN
QTRELEERVMELHRNYKGMTPAEAEINFLENAKKLSMYGVDLHHAKDSEGIEIMLGVCAN
GLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLSNHRAAKRLWK
VCIEHHTFFRLVCPEPPPKGFLVMGSKFRYSGRTQAQTRQASALIDRPPLFERSTSKRYL
LSRSLDGAEFSRPVSSMCENHDVEDHGPKMENDGCNDGSLSPTRKKEITHSPVLTQLSQS
EQETTPRHKQEFLDKSKDVLLKHQASINELKRTLREPSSKLMNREKRLSATSPAGTPEKK
AVSTGVGEGRHVSAQKMEQMKRRSQPNTTSEEELERDTLACMREPHLGIERKCSSMTVSS
TSSLEAEVDFTVIMDLHSGVEEVSKGLSELGERARQPEVGREDFEETSRFYSARLMGSRD
KSPIDGEKASEEAGHYEPPVAKKDPSAVNVAHMLKRTDSKPESHTNGSEIHPNIMNVSLQ
VKVDFIVRSKWMVTSFNNSNASMLPAGGGICVYVTSPLTIGLQVKTNIQEKDPVTSLLTI
TAENVTSATTTQVTKTVKGGYSETRIEKRIIITGDDDVDQHQALAMAIQEAKQQHPDMLV
TKAVVIRESESPTEELPHRAQVA
Download sequence
Identical sequences H3C167
ENSTNIP00000001983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]