SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002019 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002019
Domain Number 1 Region: 23-278
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.83e-94
Family Protein kinases, catalytic subunit 0.0000105
Further Details:      
 
Domain Number 2 Region: 670-781
Classification Level Classification E-value
Superfamily KA1-like 3.27e-26
Family Kinase associated domain 1, KA1 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000002019
Domain Number - Region: 292-340
Classification Level Classification E-value
Superfamily UBA-like 0.00033
Family UBA domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002019   Gene: ENSTNIG00000018983   Transcript: ENSTNIT00000002446
Sequence length 781
Comment pep:known_by_projection chromosome:TETRAODON8:16:6574375:6586384:1 gene:ENSTNIG00000018983 transcript:ENSTNIT00000002446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSRSLGARCRNSIALCSDETPHIGNYRLLKTIGKGNFAKVKLARHILTGREVAIKIIDKT
QLNPTSLQKLFREVRIMKTLNHPNIVQLFEVIETEKTLYLIMEYASGGEVFDYLVAHGRM
KEKEARAKFRQIVSAVHYCHQKNIVHRDLKAEMLLLDADSNIKIADFGFSNEFSVGSKLD
TSCGSPPYAAPELFQGKKYDGPEVDIWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKY
RIPFYMSTDCEGILRRFLVLNPAKRCSLEQIMKDKWINIGYEGDELTAHIEPVEDFNDTS
RIDVMVGMGFTREEIRDSLNTQKYNEVTATYLLLGRKNDTENVVTRSSSSLSLARVRPGT
VTNGTAASSSAGAKAQRSASTYHRQRRHSDFCGPGVSTSTHPKRSPSGVSEGVGLKEERL
SVRKPSTSTIGSRNIPTPSSPMVSSAHNPNKAEIPDRRKDMTSTTNNIPASAMTRRNTYV
CTDRANADRHSLLQNGKETRIKDLKHGRVASSVPSMSPRRDETLSAHDVTTARPCIKYPR
CSDSDAAYVPACGFISLSHRLPPASPSTHSIAGASGASSSSSTPSSRLSRGTTVRSTFHG
GQIRDRRPPSHAPPGSPTPSHDASPLPHARTRATTNLLSKLTSKLTRRVTLDPTKRQSSS
HTDTTALRSSSRHLPGHQKASEPRTPRCGWDVRVRSPRDPAEVVLALREAAQGCGCQVHL
AGPFLLSCTHGVAGARVAFEAEVCQLPSGLGQSSGVRFKRLWGAPLAFRDIATKVSKELE
L
Download sequence
Identical sequences H3C1A3
ENSTNIP00000002019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]