SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002021 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002021
Domain Number 1 Region: 230-355
Classification Level Classification E-value
Superfamily Cadherin-like 1.96e-32
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 443-569
Classification Level Classification E-value
Superfamily Cadherin-like 1.23e-29
Family Cadherin 0.0029
Further Details:      
 
Domain Number 3 Region: 343-447
Classification Level Classification E-value
Superfamily Cadherin-like 9.16e-23
Family Cadherin 0.0022
Further Details:      
 
Domain Number 4 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 1.16e-21
Family Cadherin 0.0074
Further Details:      
 
Domain Number 5 Region: 558-666
Classification Level Classification E-value
Superfamily Cadherin-like 8.28e-19
Family Cadherin 0.0022
Further Details:      
 
Domain Number 6 Region: 29-125
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000371
Family Cadherin 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002021   Gene: ENSTNIG00000005148   Transcript: ENSTNIT00000001627
Sequence length 964
Comment pep:novel chromosome:TETRAODON8:1:6788523:6798900:1 gene:ENSTNIG00000005148 transcript:ENSTNIT00000001627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGQRKRSGGGRLWRLCFSLACLSCASAQLSYSVSEELSPGSVVGNIAQGLGLSAGEIV
QRRLRVVSDHTTQYFEVKETTGDLVIKQKIDREQLCELSSTCSLHVQVLLENPLDFQRVE
VDILDVNDNAPRFSTTNISLEISEAAAQGTRFRLESAHDPDVGSNSLRTYHLETNDFFKL
KVETKSDGTKFPELVVEKALDRETQASFRLLLTALDGGQPEKSGSTLLLIKILDVNDNAP
VFNEPVTRVRLLENVALGTLVTKLNATDADSGSNGDISFLFSKYTSERVLNVFSVDSKSG
EIRVKGDVDYEKNSVYHFTVQARDGGSPAMEGSCNVIVDVIDVNDNAPEVTLTSLNSPIR
EDSAPETVIALISVRDLDSGVNGKVMLTIQPGLPFRLNSAFSMHYSLITAGQLDRESVPE
YTVVVKAADGGSPPLSSQTTFVVKLSDVNDNAPTFSQPSYSIDIQENNALNAPIAVVSAT
DPDLGDNSRIAYSILPSTVLGSPISSYVYINPESGHIYSMRSLDHEQLNAFRIEVQARDA
GTPARTANVTVHVFVVDVNDNAPVLVHPSLLKDKRLELTVPPSATPGYFISKLVGVDADS
GHNAWLFYSVASGPNAGMFRIGAHSGELRTAHKWAEEEGSAYDIVVIIQDNGEPPKSCSV
NVSIVVDEKSAVDDAPVIPRHTPFYNRKGMSDITLYLIISLACVSAVSFITFVIVMVRCL
RHRGPGLGGSDSCCYGRHRSSRYHQRPSKDLHLQLNTDGPIRYMEVVGGAQDPHTRTYRP
CYSTISSRSDFVFMKTPMLSHNNTLNTTLSRKYLMNSASEQKPPNNDWRFTQGQRPGPSG
ETGGKTECMDRPWPQPPTEAEQLQALMATANVSEATANLGPGTMGLSTRYSPQFTLQHVP
DYRQNVYIPGSTATLTSNPQQQQATAQQAAQQALPPPQASAQPEPPKAAQTPASKKKSTK
KEKK
Download sequence
Identical sequences H3C1A5
ENSTNIP00000002021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]