SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002030 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002030
Domain Number 1 Region: 231-356
Classification Level Classification E-value
Superfamily Cadherin-like 4.58e-30
Family Cadherin 0.0026
Further Details:      
 
Domain Number 2 Region: 446-569
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-30
Family Cadherin 0.0019
Further Details:      
 
Domain Number 3 Region: 128-235
Classification Level Classification E-value
Superfamily Cadherin-like 9.68e-24
Family Cadherin 0.0055
Further Details:      
 
Domain Number 4 Region: 344-449
Classification Level Classification E-value
Superfamily Cadherin-like 2.88e-20
Family Cadherin 0.0024
Further Details:      
 
Domain Number 5 Region: 560-665
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-17
Family Cadherin 0.0065
Further Details:      
 
Domain Number 6 Region: 28-95
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000005
Family Cadherin 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002030   Gene: ENSTNIG00000002645   Transcript: ENSTNIT00000001035
Sequence length 954
Comment pep:known_by_projection chromosome:TETRAODON8:1:4865:124016:-1 gene:ENSTNIG00000002645 transcript:ENSTNIT00000001035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRVTMRQYKRYVAIMALLSFVSRTSASVRHYSIPEEMKEGSVVANIATDLGLDVKTLND
RKMRLDSVASKKYLDVNKETGELYVVEKIDREHICPTKTLTNCYLKMEVILENPLRIFNI
ELEILDINDNAPQFRRDAIHLDISELTSVGERFSLSNAADPDVGSNSVKTYYLSENDHFK
IEIQTGRDGSKLGELILKKALDREQQSVHNLILTAVDGGKPARSGTASVIVRVLDTNDNS
PTFDKSHYDLKIMENSPIGSLVIHLNATDLDEGSNADLTYSYSLYTSEKTQETFHLNPST
GEITVKGLLNYEDLKIYDMEVIATDKGANSLSGQCTIKVLVEDMNDNHPEISIKSFKTPV
KENIDVETVIAVVSVSDKDSGDNGVVDLHIPDKMPFKLRQSSDNYYELVVSEPLDREKVP
EYDITFTVTDRGSPPLSDNETMTLELLDVNDNVPRFPQSFYTIRVTENNAPGALLSSLTA
FDPDLHENQYLVYFILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEFLFHIEARD
SGSPPLSSNVTVHIVIVDQNDNAPVIVSPWRAQGSVVEEKIPRSTDKGSLVAKVIALDVD
SVHNSRITYQLLQVTDATLFSLDQYNGEIRTMRMFSYRDPRHQRLVVVAKDNGDPALSAT
VTIKLSTVETAVKAYSDMTEVPLEYDIFSDLNLYLVIGLGSVSFLLLITILVTIVIKCQK
PKASKAAPACRNSVISERNSTIADSTLVSNDAYWYSLFLAETRKGKLVVRQPVPKGSRYI
VSSIPRGTGLTDTSGSAPSTLQPKMPSADWRYSASLRAGGVMQSSVHMEESSVMQGAQGV
LVQNWPTASSAADAEGGEVSPPMGAGVDSNSWHFRYGPGGPGAPPQHLKPGEVPPEAFII
PGSPAIISIRQNQGGEDDKSDFITFGKKEEAKKKKKKKKEKKDKKDKGKDDGDE
Download sequence
Identical sequences H3C1B4
ENSTNIP00000002030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]