SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002042 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002042
Domain Number 1 Region: 732-808,847-934
Classification Level Classification E-value
Superfamily RUN domain-like 3.27e-35
Family RUN domain 0.0021
Further Details:      
 
Domain Number 2 Region: 941-1039
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 1.25e-16
Family Lipoxigenase N-terminal domain 0.041
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000002042
Domain Number - Region: 624-697
Classification Level Classification E-value
Superfamily SAICAR synthase-like 0.0752
Family Inositol polyphosphate kinase (IPK) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002042   Gene: ENSTNIG00000009371   Transcript: ENSTNIT00000002032
Sequence length 1117
Comment pep:known_by_projection chromosome:TETRAODON8:5:6447317:6464278:1 gene:ENSTNIG00000009371 transcript:ENSTNIT00000002032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSLKMTTGFSSGSCRFADYFVICGLDTESGLEPDELSGENFEQSPLRRTFKSKVLAHFPD
NVEWNPFDQDAVGMLCMPKGLAFRTQVDSREPQFHSFIITREDGSRTYGFALTFFEEVTS
KQICSAMQTLYHMHNAEQYDILHTPILPPGSEEQRHQHAHLRPVLHAAPAISRLQRFNSY
DISRDTLYVSKCICLITPMAFPQACRKVLQQLHQAVSSPSPPPLPLESYIYNILYEVPLP
PSGRSLKFSGVYGPVVCQRPSTSELPLFEFPISEVFDLLGVENVLQLFTCALLEMQILLY
SQHYQKLMTVAESITALMFPFQWQHVYVPILPASLLHFLDAPVPYLMGLHSNGQDDRTNL
ELPQEANLCFVDIDNHSVELPEDLPQFPNKLEFIQEISEVLMSFGVSPEGSVNSCESQPS
YRGFRSVDMASDKRNGNLASPLNSYLLKENQTIARLQALVKRTGVSLDKLEVREDASGSR
DGRSQCDEQELKMHQVNIHVREVFANRFTQMFADYEVFVIQPSHDKESWFTNRDQMQNFD
KASFLSDQPEPYLPFLSRFLETQMFASFIDSKILCPDDEEKDHTLRVFDSRVDKVRMLNV
RTPTLRTSMYQKCTTIEEAEKAIEMRVSKIDHTALHPHLLDMKIGQGRYEQGFFPRLQSD
VLSTGPTSNKWAKRSAPAQWRRRDRQKQHTEHLYMDNDQREKYIQEARNLGTTIRQPKLS
NLSPSVIAQTNWKFVEGLLKECRNKTKRMLVEKMGREAVELGHGEVSITGVEENTLIASL
CDLLERIWSHGLQVKQGKSALWSHLLHFQENKEKNSTPGSLGPPGLIHDTERRKSDGGLS
AMAPLKVSLIQDMRCRHIQNMSEIKTDVGKARAWVRLSMEKKLLSRHLKQLLSDHELTRK
LYKRYAFLRCDDEKEQFLYHLLSFNAVDYFCFTNVFTTIMIPYHVVVVPSKKLGGSMFTA
NPWVCVSGELSETGVLQVPRNTLEITFECQNLGKLTTVQMGHDNSGLYAKWLVECVVVRN
EITGHTYKFPCGRWLGKGVDDGSLERILVGELMTPTTENDERMCRTPPQQSPGMMRRFVT
ISLKHQTNPELNTGQIQEGVGEAINGIVKHFHKPEKE
Download sequence
Identical sequences H3C1C6
ENSTNIP00000002042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]