SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002046 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002046
Domain Number 1 Region: 78-263
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.13e-46
Family Astacin 0.00023
Further Details:      
 
Domain Number 2 Region: 271-384
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000222
Family MAM domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002046   Gene: ENSTNIG00000006408   Transcript: ENSTNIT00000000637
Sequence length 417
Comment pep:novel chromosome:TETRAODON8:8:757922:760527:1 gene:ENSTNIG00000006408 transcript:ENSTNIT00000000637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVLAIPAKTVSKEFLSYLHFLEVKTNVRKEKDITEANEDRDDILEVSRLSFYNLFLNNA
HTYPPKIQRSAVADLDSRWQSPVPYVLDKSLEMNAKGIILQAFDQFRIKSCIDFKPWDSE
RFFLIMKKLDGCFSYVGKVMANGQELSIGASCDSISIAEHEILHALGFYHEQSRYDRDDY
VEIVFENIQSGKENNFRKVNKNDSITNGVPYDYLSVMHYGKNAFSNGIGPTIVTKDPAFQ
DVIGQRLEMSPSDVLELNRLYNCTSSVAFMMGCSFSGGSACEMSKCEDGDVVWTMVTQAD
GGPSRDHTHLPNGNGSQVPGVGYFMHANTAAGMEGDSAWLETKRLTPTRSCPVQCLQFYF
CQLGNQTDQLNIWVREFQDERDQTGTLRLVDQITGAFQILHLGDKIDLWRIHHVSLN
Download sequence
Identical sequences H3C1D0
ENSTNIP00000002046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]