SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002049 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002049
Domain Number 1 Region: 448-574
Classification Level Classification E-value
Superfamily Cadherin-like 1.3e-31
Family Cadherin 0.0011
Further Details:      
 
Domain Number 2 Region: 237-358
Classification Level Classification E-value
Superfamily Cadherin-like 1.06e-29
Family Cadherin 0.00039
Further Details:      
 
Domain Number 3 Region: 134-241
Classification Level Classification E-value
Superfamily Cadherin-like 4.59e-22
Family Cadherin 0.0045
Further Details:      
 
Domain Number 4 Region: 348-452
Classification Level Classification E-value
Superfamily Cadherin-like 7.99e-19
Family Cadherin 0.0058
Further Details:      
 
Domain Number 5 Region: 564-673
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000117
Family Cadherin 0.0064
Further Details:      
 
Domain Number 6 Region: 37-117
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000828
Family Cadherin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002049   Gene: ENSTNIG00000001476   Transcript: ENSTNIT00000002559
Sequence length 813
Comment pep:novel chromosome:TETRAODON8:1:6711563:6717483:1 gene:ENSTNIG00000001476 transcript:ENSTNIT00000002559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRWISSYGTLKWRFCFSRMSQILLILLYLVCNVGCQIRYSIPEEMKKGSLVGNIASDLG
INVQRLRSGRARIVTGENSQYAELKADKGMFVVNERVDREKLCGDMTPCSFSFDLILENP
MELHHITVEVLDMNDNSPFFHQHDMQLTIGESAAPGARFVLPTANDPDVGVNGLQEYYLS
PNDNFVLKTHSNSDGRKYAEMVLEKPLDRERHPNLSLKLIAVDGGTPQKSGTVNIEIFVL
DANDNSPVFNQTVYKASVREHAPKGTYIITVNATDADSGSNGLIYYSFSKMQGSIDGIFD
IDKITGVISLSGSIDFEKNKKYEIGIEASDQGALTDSSKVIVDVIDLNDNPPVINVMSLT
SPIAEDSPPGTTIGIINVKDLDSGDNGHVNCRIEQNTPFKVKSGLRNYYTLVTDALLDHR
ESVSDYNITVIASDAGTPALSTKKNFNIKISDVNDNAPVFPQAVYSAYVVENNSPGVSVL
TLRAKDPDENQNARISYILEDTDIGASPISEYISVNAESGVIHAVKSFDYEQIKQLVFMV
RAQDGGSPPLSSNVSVRILIQDQNDNPPQVLYPVQTGGSMVAEMVPRSADVGYLVTKVVA
VDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTVRQVSDKDAVKQRLSVIVEDNGQPS
RSATVIVNVAVADSFPEVLSEFTDFAQDKEYNDNLTFYLVLALAVVSFLFITCLVVIVSV
KIYRWRQSRILYHSSLPVIPYYPPRYSDTLGTGTLQHVYNYEVCRTTDSRKSDCKLGRAA
SQNVLIMEPSSTGTMQRIQSDKSILDEPDSPLE
Download sequence
Identical sequences H3C1D3
ENSTNIP00000002556 ENSTNIP00000002049 99883.ENSTNIP00000002049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]