SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002081 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002081
Domain Number 1 Region: 82-331
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 6.12e-83
Family Myeloperoxidase-like 0.0000000127
Further Details:      
 
Domain Number 2 Region: 1-38
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000208
Family EGF-type module 0.00067
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000002081
Domain Number - Region: 42-86
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 0.00265
Family Myeloperoxidase-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002081   Gene: ENSTNIG00000001299   Transcript: ENSTNIT00000000363
Sequence length 332
Comment pep:known_by_projection chromosome:TETRAODON8:12:5003193:5006918:-1 gene:ENSTNIG00000001299 transcript:ENSTNIT00000000363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNPCCYYPCQNRGVCVRYGTDQYKCDCTRTGYSGVNCTDPGFWAKVHTMLKPSPQVQDYI
LRHFEKFWDYVNNSPLRDTFMRIVLTGETIKIIIEEYVQQLSGYFFKLKFDPTLLFKEQF
QYSNRIAVEFDHLYHWHSLLPDSYLIDGDEISATGFVFNGSVLANYGVEKMVDSFSRQIA
GQIGGGQNFHESIIRVIRSLLHHGREVRLQPFNEYRKKFDQKPYESFSELTDNEEIAKGL
EEAYGDIDALEFFPGIMLEKTSPGHIFGESMFQMGAPFSLKGLMGNAICSPEYWKPSTFG
GETGFNIIKTATLEKLVCLNTKWCPYVSFRVP
Download sequence
Identical sequences H3C1G5
99883.ENSTNIP00000002081 ENSTNIP00000002081 ENSTNIP00000002081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]