SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002189 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002189
Domain Number 1 Region: 284-473
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 6.15e-78
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.0000000264
Further Details:      
 
Domain Number 2 Region: 31-125
Classification Level Classification E-value
Superfamily A heparin-binding domain 2.62e-44
Family A heparin-binding domain 0.00000254
Further Details:      
 
Domain Number 3 Region: 126-190
Classification Level Classification E-value
Superfamily Amyloid beta a4 protein copper binding domain (domain 2) 1.44e-29
Family Amyloid beta a4 protein copper binding domain (domain 2) 0.0000193
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002189   Gene: ENSTNIG00000014537   Transcript: ENSTNIT00000002509
Sequence length 672
Comment pep:known_by_projection chromosome:TETRAODON8:3:6018974:6031299:1 gene:ENSTNIG00000014537 transcript:ENSTNIT00000002509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKADLAIRMFVATDSSKAIDVPTDVSMGLLAEPQVAMFCGKINMHINVQSGKWEPDPSG
TKSCIGTKEGILQYCQEVYPELQITNVVEANQPVSIQNWCKKGRKQCRSHMHIVVPYRCL
VGEFVSDALLVPDKCKFLHQERMNQCESHLHWHTVAKESCGDRAMNLHDYGMLLPCGIDR
FRGVEFVCCPAEAERDMDSTEKDADDSDVWWGGAENDYSDNSMVREPEPAEQQEETRPSV
IDEIDAFGESDDVDADEPTTNVAMESVEEVVRVPTAMPSSPDAVDHYLETPADENEHAHF
QKAKESLEAKHRERMSQVMREWEEAEREARNLPRADKKIVIQQRFQEKVEALEQEAASER
QQLVETHMARVEALLNDRRRLALESYLTALQQDPPRPRHVFSLLKKYVRAEQKDRQHTLK
HFEHVRMVDPKKAAQIRPQVLTHLRVIEERMNQSLGLLYKVPGVADDIQDQVELLQREQA
EMAQQLANLQTDVRVSYGNDALMPDQELGDAQADLLPQEDTLGGVGFIHPESFNQLNTEN
QVEPVDSRPTFERGVPTRPVTGKSMEAVPELRMETEDRQSTEYEVHHQKLVFFAEDVGSN
KGAIIGLMVGGVVIATVIVITLVMLRKKQYTSIHHGIIEVDAAVTPEERHLSKMQQNGYE
NPTYKFFEQMQN
Download sequence
Identical sequences H3C1S2
ENSTNIP00000002189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]