SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002223 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002223
Domain Number 1 Region: 40-164
Classification Level Classification E-value
Superfamily C-type lectin-like 2.53e-32
Family C-type lectin domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002223   Gene: ENSTNIG00000001273   Transcript: ENSTNIT00000001944
Sequence length 164
Comment pep:novel chromosome:TETRAODON8:Un_random:68425563:68426877:-1 gene:ENSTNIG00000001273 transcript:ENSTNIT00000001944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTVLVLSALLYAALAGLTHKNGAPDGSENEKMPAEDEDEGFCPDGWLTYGFRCYIFVNT
PMNWSIAKDHCNSLGANLASVSNQREYRFLQQMTKTAGQSYAWLGGFYLQGSWLWINNEG
FNYTLWFRQFSPTTYPCLYILTNLFSDGWSNAHCSSAGPFICSK
Download sequence
Identical sequences H3C1V6
ENSTNIP00000002223 99883.ENSTNIP00000002223 ENSTNIP00000002223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]