SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002235 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002235
Domain Number 1 Region: 155-267
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.55e-34
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 2 Region: 271-383
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.77e-29
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 3 Region: 39-152
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-25
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 4 Region: 9-40
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000111
Family Spermadhesin, CUB domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002235   Gene: ENSTNIG00000000730   Transcript: ENSTNIT00000000683
Sequence length 384
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:10038064:10043072:-1 gene:ENSTNIG00000000730 transcript:ENSTNIT00000000683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTTLTSLCGNLLTVHFVTDGSVQRRGFNATYMSVPLLCGGTLNATSSTQAIGSPSFPNA
YPDYTSCRWVLDAPPQETIRLSVQTFALQPSQSCSSNYLEMKDWPVGDYGQSHRFCASDG
HPVDFYSYGRTVLVHFKSDAYMTGNGLNLTFQVAGCSRNFEQEFGYLKSPGWPEVYPHDL
DCIILLKAPQNSSISLFFNSFDVESHPSCQFDYLEIRNGSTADSPLIQRLCGSTIPDPVF
PQSNHLYLRFKSDFSMARDGFEVTWTSSPHGCGGALYGDHGSFTSPNYPGTYPNGSHCEW
SVTAPRGRLPTVTFAQIYIDDPGSCQNNYLKLYDGPDASSQPVGPYCGPETNIAPFTASS
HQVFVVFHAQSASLPSGFRLTWSS
Download sequence
Identical sequences H3C1W8
99883.ENSTNIP00000002235 ENSTNIP00000002235 ENSTNIP00000002235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]