SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002258 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002258
Domain Number 1 Region: 2119-2396
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.63e-96
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000584
Further Details:      
 
Domain Number 2 Region: 649-757
Classification Level Classification E-value
Superfamily Second domain of FERM 4.71e-29
Family Second domain of FERM 0.00043
Further Details:      
 
Domain Number 3 Region: 759-865
Classification Level Classification E-value
Superfamily PH domain-like 1.57e-27
Family Third domain of FERM 0.0026
Further Details:      
 
Domain Number 4 Region: 1301-1398
Classification Level Classification E-value
Superfamily PDZ domain-like 8.28e-27
Family PDZ domain 0.0002
Further Details:      
 
Domain Number 5 Region: 1060-1163
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-26
Family PDZ domain 0.0064
Further Details:      
 
Domain Number 6 Region: 1437-1540
Classification Level Classification E-value
Superfamily PDZ domain-like 2.63e-21
Family PDZ domain 0.021
Further Details:      
 
Domain Number 7 Region: 1715-1802
Classification Level Classification E-value
Superfamily PDZ domain-like 9.33e-19
Family PDZ domain 0.0074
Further Details:      
 
Domain Number 8 Region: 557-648
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.58e-17
Family First domain of FERM 0.0074
Further Details:      
 
Domain Number 9 Region: 1813-1899
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000999
Family PDZ domain 0.033
Further Details:      
 
Domain Number 10 Region: 1949-2012
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000453
Family PDZ domain 0.015
Further Details:      
 
Domain Number 11 Region: 47-161
Classification Level Classification E-value
Superfamily PAZ domain 0.000000011
Family PAZ domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002258   Gene: ENSTNIG00000007533   Transcript: ENSTNIT00000000266
Sequence length 2401
Comment pep:known_by_projection chromosome:TETRAODON8:4:6757339:6779980:1 gene:ENSTNIG00000007533 transcript:ENSTNIT00000000266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVSLAEALEVRGGPLLEEEVWAVLSQSAESLQELFHKGTQAYPSAMGFIISPWSLLLMP
SGNVSFTDEYVTQQDLRAFTAPEVLEGLSLSSVSDIEKMHMYSLGMTLFWGADYEIPQSQ
PMKLGEHLNSLLLNMCDDVTLSRISLRTVLDICSKHIRNSACDPPFSYIRKLVRLVLGSL
SQLDGLLTDRESLPERSKEIRERLRGKGLPSGRSAAPRVLERYRARTQEQTSLNRGLSRS
MGSLPIQGRLLKADEGATQQYSSSDYHPKSDSPTELYPKPLSLQLQHSYPARKTWASSVD
LACIDPEALRFGALEDARRGSTAISAHTIGRHKEKDFHYSEFGGLKNRKPYHFSASSVGS
GAYDRIKERQRKLQALQQAVDAPTDPLPTHQRYHSDFSSSSESPSVTSSDPDYGQGKKLA
EVRRYGSQMALPSEQDALSLTSHNTHRVRQFEGAADEGLAGAELLLQKQEEEVQRLQAHL
ASRLSRASLYPTDDPPAPSHMSMLDLRDPLYPHRKPKNFHGPEFVKMASEPCVALSVPSS
IMLSLHKKRGKVEEVQRKVGVVLLNGQKLELSCDIKAVCKDVFDMVVAHIGLVEHHLFGL
ASLKDNEFFFVDLDAKLSKIAPEGWKEDPKRKKTDVPFNLFLRIKFFLDDINLIQHSMTK
HQYYLQLRKDILEEKMRCDTTNAMVLASLALQAEFGDYQPELHGKTYFRLEHYLSASVLD
KLNHSAIKEELSKLHSNYYEASDAEAELEFLKVCQRMTEYGVHFHRVLPEKRSQTGIMLG
VYSKGVLIFEVLNGNRTPVLRFPWRETKKISFTKKKICLQNTSDGIKHLFQTDSNKTCQY
LLHLCSDQHKFHLQMKARQNNQELQDLENSPLSSLQYPFDPRSGDMVGRTTSSGSLAPTF
STQSNPDHLKRISYSEVALNKAPPGSVLVQDDLHFPGFNPASSAIITNPRVMSRSHHNLG
QMPESPEQRVVLHGPLSPHGPQQHQRAGSDPNALLPRQEKSGAGTNISPVWNLSRSNKES
DASSIEDSGQAYVVGVSMHSSSGLPSTPASVNDSFKKKLSALPSPERDITTVNLKKDAKY
GLGFQVVGGEDSGRADLGTIISSITPGGPADVNGSLKPGDRLISVNDTNLLGLSHANTVD
ILQNAPEEVTLVVSQPKERLYRESPSPPPHSSDAAASSLSPVHQQSSVPDPKTNAVKTKP
NGVQQCLDRILATAATSSTGQPHKPAAHRSLDPVPPALPPKTRRAKFSEAPKAPEHPDRG
DSDMDEENHCNSQGKHVPACRNSPRCPVLCLQEIIMERFSGNAPGPGDLFDVALSKKDSS
LGLSVTGGANTTVRHGGIYVKAVIPKGAADLDGRIQKGDRVVAVNGKSLEGATHQQAVEI
LRDTGQTVQLLLEKGHPPAERVHTINTSHCLSPSDGTDKDQIASKEEVREVKEKPEYSFV
TPDNVFEVCLLKNTSGLGFSFSREENVPNEPLGSSMVRVKKLFPGQPAAESGRISVGDVI
MRVNQTALKGLSQHEVISALRGAGQEVTLLLCRPERGILPEMDALTMTPVPSPRKEPVTA
VQPSLTFTKSTSTQSKKSQALVLEALERLQPKSPGRQNSYSDSTDGDEEVEEVFAAEHSR
RAWERSVYHTPGGTLGLGEYDSTGQLDDTVHSAFYSPKLSMTRSDLSKGSPPSPVGADLE
SVPASAPSPDPLPPPLPLPLNLTMSSNGQEMEDFVPEVELKVSLVKSDKGSLGFTLTKGN
DHGCYIHDIVQDPAKGDGRLRAGDRMIMVNTTDVSNMSHTEVVNLVRAAPRVVDLLVGRV
LEAPKPPIEAHLLPDIWFNGNQEPLGLVLSGGSDSIYGVLFVKDILPGSAAFDEGSLRPL
DLIHYINGAPTQDLTLSDSNRLLDLTFDNLSLKATRDGQPVFPAQKSDSLVNNNNNTSPN
VSSSVNGIPPILLLSFVYSFIYCKVCLGGERGIFVKSITPGGIADTSDKLQIGDRLLKDN
THLKTSLLLLQVNDEVMTGVSHTKAVTTIRKNYDEGPVEEAREAELSEDTDCDGSSLPED
SPEIKSSTRGQNLDFKSVSPITEFTMSAGQPEEDEITWGSDELPMETLDSKLRDDGPIIT
EEELTCLPLIKVVPDGQYTGAKLNSVVRMMRGLLEQKVPLQEFDNLQNLEPLDDCLIAQT
KENKKKNRYKNVVPFDTTRVLLGKDGGYINANFIKMSVKDENYMYIACQGPLPTTLSDFW
QMVLEQKSNVIAMMTREVEGGKVKCQRYWPDTPMMPEMVDDRLQITLIKDQFLENFGIRL
IEVKDIQTNETQLVTHLNYTGWPDHGTPTQPEHLLTFISYMRHIHRSGPVITHCSAGIGR
SGTLICIDTVLGLISKDADFDISDVVRNMRLQRHGMVQTEDQYIFCYQVILYVLRCLQAE
E
Download sequence
Identical sequences H3C1Z1
ENSTNIP00000002258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]