SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002262 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002262
Domain Number 1 Region: 504-533,564-756
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.95e-48
Family Ankyrin repeat 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002262   Gene: ENSTNIG00000016064   Transcript: ENSTNIT00000000262
Sequence length 1477
Comment pep:known_by_projection chromosome:TETRAODON8:13:11187539:11806022:-1 gene:ENSTNIG00000016064 transcript:ENSTNIT00000000262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRQIRSCVVVIDRAEQMCGFFQLEMEKLQLQSLEQEHRKLTAQLKDEREKNKHIVMMLVR
ECKQLATRVVEESQRFDELQARLDEESRASGRLQEELAAERQRGQQMEAKMEKQLSEFDT
EREQLRARLGREEAESLSLRQQVEQLRTEPGDGKDGAPAAAAVTPPKPEAFTSVSVATEP
VGSRTASCQTDPPPAEAEVPRKNPLTIPVKPTPANYVGLSLPKTTGRGIIHSSSGGLAQT
ENGSEGQAPHGLPSGVSPRVQAARYKFQEQDQNGTASQSPPARDLSPTNRDNFAAKQQAR
HTVTQVLSRFTSPPAGGAGPLRPGLPHSASEGGPFPGRLGHPIGLKSPTVGRIDRGNPPP
IPPKKPGLSQTPSPPHPPIKVVGDSSRTPAAGLKPATPQLPPKPALDLVPALTASQVGSC
SSCRSPGPGRAPPPAAACAECPPVISSTLSSPSSINPPSTSPSISAPSSRSSRSSAGSPL
AAASGWCPSVVSSLGGGGPAALDSGRPLLSQAASQGNVTLLSKLLNQPDPTTTSTSTAST
SVNTSSATAVENKPDRLDRNHHHYNHNHTSALFAAAQNGHTERVKLLLSSGSPADVSHEN
GFTPLHLAAAYGNSSCVEELLAAGAAVDAPTADGQTPLLLACEAGRLDCVRVLLTAGADR
SRTTEDGCTSLHAAVRSGHADTLRLLLGHPAQGDPAVTPDPPAGLLNQANGDGWTAAHMA
AALGLKECLGVLCSHREQDISRRDKCNRTPHDLATDDCKDLLENLDVYQALVCLQRSGGG
PGRSLRLEEPSGTAANQLVLGRVLVDRSMRWAQLSTALNQVFASYLQTVCADASAVRGET
TRLPLGLGPGSISTILIGDTELLPGQELPLSPWDLVRKPLSQSISIRIKGLFDSCLDELA
LEYLFPLPLLCNYVRLVEQYGNLIFHGLEGSCQEDMADAVACCIKSKQEAEGLGCDVVRV
EVDESLTKEQLLETFIDCGFLVPTAAASGGAARCVVVLLEGLEKASSLTGLLGDLCHSLD
TRDSSSPLLLNTGPHHFCDGSFLIATLSKPRLQGSELRLQQHFRWVTLRWDQEPLHGLLG
RQLRRRLLHQMGSGIWSPDGVMERSVLWVSQVWQQLNACLSRLGTHEALLGPQLFLSCPV
VSNNTQAVVRWLARLWNAVVVPRVEEAIIARVTTKGSAAHTPSSPPQRPSLSNCGLSAGQ
QAVVKAALSILVHKAVLPGCPLRRQEMDKYLLEFRGGLFPLSGISSYRGSAGVGGRRGRD
SSKLRRSNTSPRKKGGSTLKWSCGGSFREGSKSSTDVSFTANGKDQREPIGLSVFSDDET
DLIRELQTICSSKSEPDISKILQAKDELVLFSSARAKATPDRDAEREPASVQRLQTPGVR
QSCSSSGGQTAVPNRDRRSSPRARSQLPVPSSRGHQPRGSAASTSNGSPVRNQTPPTRGR
ISSRSKPMPPSSSSSSSSSQTQEDIWILNRDVHDSNK
Download sequence
Identical sequences H3C1Z5
ENSTNIP00000002262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]