SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002265 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002265
Domain Number 1 Region: 7-466
Classification Level Classification E-value
Superfamily Sema domain 3.4e-117
Family Sema domain 0.00000109
Further Details:      
 
Domain Number 2 Region: 1042-1313
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.42e-77
Family Protein kinases, catalytic subunit 0.00000000571
Further Details:      
 
Domain Number 3 Region: 616-707
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000743
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.069
Further Details:      
 
Domain Number 4 Region: 512-589
Classification Level Classification E-value
Superfamily E set domains 0.00000000000959
Family Other IPT/TIG domains 0.03
Further Details:      
 
Domain Number 5 Region: 469-513
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000128
Family Plexin repeat 0.00077
Further Details:      
 
Domain Number 6 Region: 707-809
Classification Level Classification E-value
Superfamily E set domains 0.000000021
Family Other IPT/TIG domains 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002265   Gene: ENSTNIG00000014746   Transcript: ENSTNIT00000000319
Sequence length 1353
Comment pep:known_by_projection chromosome:TETRAODON8:11:5562159:5569545:-1 gene:ENSTNIG00000014746 transcript:ENSTNIT00000000319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDFTVEYSLPHFQTSNPVQNIAVNWDSQQKEIYIGCQNAIKAVTGNMEEMWELKTGPVGS
PDCETCKLCDVEADPEDPVDTDSEVLVLDPAVELLPYLYICGSTQHGICYFIDISPPERA
PKCLYKKEHNSPTHCPDCLASPLGTKVTIVEEGATSYFFVAATVDDRVAQKYPRRSISMM
RPLSTEDGFDMVNNGLTVLPGLRSTYKIEYIYSFSTKDFVYFLSLQREDPSKSNSPFQTR
LGRMPISIQEVWMYREVVLECHFNPKRRRRENFKDIVYNGLQAAYFGRAGKDLVEELRVD
EHEDILYGVFAEVNELGQPQKNSALCAFPLTKINYAIDKGVEACCQSVWFFFFGFSHLIL
RDSSQDNNTCSSKPTLVAQPHYRLDLFNQKMRDVLFTAVLVTTNGNHTLGHFGTSDGRIL
QVILSLYRHVVFANYSLGDGEVSRTAAVYAEDSLLFVVGNKMFKVPSQGPGCAHFRTCSM
CLMAPRFMNCGWCSGVCSRQHECTSQWTSASCAPIITEVSPKVAPVGGETEVTLCGWEFQ
SPLRPAIINGKTHRVTVGSTTCAVLPEKSSSEKLVCKIQEKNKPGQDLKMVLEVHEGEVE
GRYSIEGSAQIRGFSFVEPSVTDLKPDSGPVFGGTTVTLTGRYLDSGSQRDVLFGDERCS
ILSVSGGPEPSSSIICRTAAAEDVGSVPVTVLIDSFQVTTTKTFHYKINPVVTSVEPRCS
VQRHRGSRLVIQGQNLDSAHKTVVKYVSKNTNLHQLQRVCNGSTNATHMECWAPAFPEEM
PDEKESGQISIHMEDQREVWNSSFEYHSNYEVLPFENEDKILLLRPGENEVSLHHKKLDR
VSACMDVTMSIGGVNCKAQVLLNELTCRIPKSLVIPASGLPVKVSVGWEVYDVGTVGNDD
SNNTKVIVGIVLGILAALVAGAVLAFAVMIHLKKKKIGEELLIPSSAGPFFVPVPSANIE
NRLSTMLSHTRSSGAADFSPTGDYRRVDLSSQTSGSGGMAFQGLLYAASYDHLAIPLMSH
DNISMVSLNPDLLEEVKNVLIPADMLRIEDSQIIGKGHFGTVYHGYLIDSNKQETHCAVK
SLNRITDLKEVNQFLREGLIMKGFDHPNILSLLGIMLPKEGLPLVVLPYMKHGDVRHFIR
SEKRNPTVKDLIGFGLQVAKGMEYLAQKKFVHRDLAARNCMLDETYTVKVADFGMARDIY
DKEYYSIQDHKQVKLPVKWMALESLQTQKFTIKSDVWSYGILMWELLTRGASPYPDVDPY
DITHYLLKGRRLPQPQFCPDTLYSIMLSCWDPEPDYRPSFSSLTADVQHILLCLQGEHYI
NLKVHYVNLDQPRPYPSLTGSADEAEASDPDTD
Download sequence
Identical sequences H3C1Z8
ENSTNIP00000002265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]