SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002280 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002280
Domain Number 1 Region: 238-328
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000003
Family Cadherin 0.0045
Further Details:      
 
Domain Number 2 Region: 89-207
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000814
Family Cadherin 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000002280
Domain Number - Region: 350-415
Classification Level Classification E-value
Superfamily Cadherin-like 0.0143
Family Cadherin 0.013
Further Details:      
 
Domain Number - Region: 40-95
Classification Level Classification E-value
Superfamily Cadherin-like 0.0989
Family Cadherin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002280   Gene: ENSTNIG00000000775   Transcript: ENSTNIT00000001602
Sequence length 774
Comment pep:known_by_projection chromosome:TETRAODON8:13:8314036:8319069:-1 gene:ENSTNIG00000000775 transcript:ENSTNIT00000001602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CVAPEDVEIPENNKVGDLVATINLQPGATVTLSPPEGSENPFLLNGTQLLAAIVFDAEKT
SSFSARLLCRPADGAQFPFIIVVLVKNLNDNPPEFQQTVYKLNVSESKNITNIKAPDLSL
KLDRKRWFLEKVFVLFLSLQHGFKLSSPTVPDILIQTPPNYDTVQKVSLTLFVQDTPLTS
PGIVPSYNDSTTVEITILDVDNRPPWFQPCTKYNSGGNVICSSSGYTGRVTLNKKEPGFL
KLNPGPLYAIDGDDGINEEITYKILGGNDGNLFEIKSNTGNVSMQREADTLETITLTVLA
SQKNNSFQATSTSVTITVLTESLHLPQFQSPRYQGSIAGVGNMALDMKNEPLQFIATDAD
YEGLNPNIDYSVSGRDEFSIVGGFLFMTKNLPEATLNLQVQVVAKDTYNDETATAELQLE
VKSGRPRGTTTKPSESTDGTGVTTAPSGTTTKPSGSTDGTGVTTAPSGTTTKPSGSTDGT
GVTTAPSGTTTKPSGSTDGTGVTTAPSGTTTKPSESTDGTGSTTNPTGTTTKPSGSTDGT
GSTTIPSGTTTNPSASTTKCSTGGCGTSAEPNQTTNGPVPTANTPRPLTVIVPSGGYGSN
DMAALGATLGVLLCVCLVFKITKKKNIVPPQLNKGFGGEKEGIQYTNDAFTNDEDGSSTR
SGSPDRRTVIAPEQPRTIAPGLEKYLTSKEPSGPAQDDVASQSGSDGDDKEKEVKPILTK
GRKQDEGYKSVWFKEDIDPEAMEEVVIIPDSRENDSDNEEQQQTGSHGEESNRG
Download sequence
Identical sequences H3C212
ENSTNIP00000002280 99883.ENSTNIP00000002280 ENSTNIP00000002280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]