SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002297 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002297
Domain Number 1 Region: 278-626
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 7.72e-89
Family Hect, E3 ligase catalytic domain 0.0000874
Further Details:      
 
Domain Number 2 Region: 1-175
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 8.63e-38
Family Regulator of chromosome condensation RCC1 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002297   Gene: ENSTNIG00000001449   Transcript: ENSTNIT00000000686
Sequence length 650
Comment pep:known_by_projection chromosome:TETRAODON8:4:6667007:6670852:-1 gene:ENSTNIG00000001449 transcript:ENSTNIT00000000686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FGDGDYGKLGAGSSTAKYYPQKVEQLCNKGMKKVCCGAQFSVVLATDGHVYTFGQERLIG
LPDSMLKNRSNPQVVPSLEGLFIEDIAVGCEHVLALSSTGDIYAWGCNSEGQLGLGHCNL
VKEPTLITALQGKNIKQISAGRCHSSAWTAPSTSKNSGGPGSVQLGLPQSVPPQYNTLKD
LSPRVLSMRLRVLHNFSDLMYKSWRLLNLDPKNPTSTSRYSSGTTAIIRGELRGLLSPKV
NTLPLVRCIGRTMTQGKTHGPQITVKRISTRGRSSKPIFVQIAKQVVSLNPLELRLPSRA
WKVKLVGEGADDAGGVFDDTITEMCQELQSGVVDLLIHTPNGFADVGSNTDRFLLNPAAF
SEDHMIQFRFLGVLMAVAIRTRKPLDLHLAPWVWKQLCSIPLGGSDLEEVDLLSYRTLQG
ILHLENSGITEENFHVMIPLDSFMVHSADGRLVPVVPGGQNISLTFANRTEYVERGLDYR
LHEMDSQVAAVREGMSTIIPVPLLSLVTPQQLEQLVCGLPEVSVEMLKKLVRYRDITEGH
QLVGWFWQSLEEFTNEERVLFLRFVSGRSRLPSNPADITQKFQIIKVDRPVNGLPTAQTC
FFLLRLPPYTSQAILSERLRYSIHNCLSIDMDNYMLTHNTEPADSSGTED
Download sequence
Identical sequences H3C229
ENSTNIP00000002297 99883.ENSTNIP00000002297 ENSTNIP00000002297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]