SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002331 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002331
Domain Number 1 Region: 834-942
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-25
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 2 Region: 308-426
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.32e-19
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 3 Region: 32-152
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.3e-16
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 4 Region: 269-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000126
Family EGF-type module 0.018
Further Details:      
 
Domain Number 5 Region: 637-755
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000314
Family Growth factor receptor domain 0.0068
Further Details:      
 
Domain Number 6 Region: 159-307
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000738
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 7 Region: 715-830
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000968
Family Growth factor receptor domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002331   Gene: ENSTNIG00000009373   Transcript: ENSTNIT00000000970
Sequence length 1018
Comment pep:known_by_projection chromosome:TETRAODON8:5:6471641:6484277:1 gene:ENSTNIG00000009373 transcript:ENSTNIT00000000970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAIWAARDLCLFLLLLNSHQSGALPEIRDPCAKGSDGCHIDAICQTTQGSYKCTCKAGF
KGDGHHCEDTDECDLEFNGGCVHQCNNIPGNYRCTCYDGFHLAHDGHNCLDVDECRFNNG
GCQHICVNTVGSYECRCKDGFFLSDNQHTCIHRSVEGLNCMNKEHSCAHICKETPKGGVA
CECRPGFELARNQRDCILTCNHGNGGCQHTCEDTENGPICRCHPRYNLQPDRRSCKERDE
ASSDASDHNSTSFTEVDKRVKRRLLMETCAVNNGGCDCTCKDTSTGVRCSCPVGFTLQPD
GKTCKDIDECELHNGGCEHFCRNTIGSFECNCRKGFKLLTDERSCQDIDECFFERTCDHT
CVNSPGGFQCLCNKGYTLYGLAHCGDINECSVNNGGCEHGCENTVGGFECFCHPGYKLHW
NKKDCIEAQGLPLANPPSKATLNCSKQEGGDRCSLTCQSQVHISSGMEDSYTVTCGMPLP
CLADAQRNNSGLSCLGSEKATVPRIKTTATFKSGTSKCNLKRSQETLKQSLNSALPGTRV
TKNVQFSYVRLRCTSSGQKPRSRHGRKASEEDGSSITAEFELDVNLEEVTAEGCDLSCVR
RRSEKRLRKTIRTLRKSINREQFHLHFAGSDYELGRSQSQPAELPGRCAMGQMPVGKKCV
SCGVGTHYDGDQGRCVLCPAGTYQDEEGQMFCEPCPGPEGREVSKVVGARNMSECGGQCS
PGQYSRDGFVPCLLCPLGTYQSEVGRTTCFPCGGNLVTKRIGAVTFQECETKVQCSPGHY
YNTSTHRCIRCPTGAYQGEFGQNYCVACPGNTTTDFDGSTNIMQCKNRQCGGQLGDFTGY
IESPNYPGNYPANVECTWTINPPPKRRILIVVPEIYLPIEDECGDYLVMRKSSLSNSVTT
YETCQTYERPIAFTSRSKRLWIQFRSNEGNSGKGFQVPYVTYDEDYQELIEDIVRDGRLY
ASENHQDILKDKKLMKALFDVLAHPQNFFNYTAQESREMFPKSFIRFLRSKVLRFLRP
Download sequence
Identical sequences H3C263
ENSTNIP00000002331 99883.ENSTNIP00000002331 ENSTNIP00000002331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]