SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002355 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002355
Domain Number 1 Region: 141-233
Classification Level Classification E-value
Superfamily SAND domain-like 1.19e-29
Family SAND domain 0.00093
Further Details:      
 
Domain Number 2 Region: 424-465
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.000000000138
Family MYND zinc finger 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002355   Gene: ENSTNIG00000016068   Transcript: ENSTNIT00000001212
Sequence length 488
Comment pep:known_by_projection chromosome:TETRAODON8:13:11241917:11245420:1 gene:ENSTNIG00000016068 transcript:ENSTNIT00000001212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGSDTESEAEVTTMAVMAEPGNIDIGAESLPNPDEAEAAFAVADVTTVTVGDVQAAEDNV
FTTTVATSDSLPEHMLSGRTTLQLGEGLSTQKATLIVVHTDGSLVEAAGLKPAAAMASPG
PQTPPTPLSPPQVKESCSKYNWDPSVYNNELPVRCRNTSGVLYKNRLGSGGKGRCIRHSQ
QWFSPTEFEGLAGRASSKDWKRSIRYAGRPLLCLIQERILNPHAASCTCAACCDDLAETG
PVRLFVPYKRRKKDESAVSPPKKLPVAKNITLAPGTTSVTVSPSGQFTTSGTLTFDRTPA
GDIISEGSAQSEVFTSTAGGWRCTGPGAPGSEFNTHQLPRSSSSAVLAALPALAVSPQPV
HAKMTGAASPSNGLIEAQKNTWMYLEELANTLLSNMQQLKALIEQAKNASGDIAGVRGHG
GRKEQMCVNCGRVAISECTGCHKVNYCSAFCQRKDWKDHQHICCQSSGGVAVHEDEHITP
MDMDKVSL
Download sequence
Identical sequences H3C287
ENSTNIP00000002355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]