SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002403 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002403
Domain Number 1 Region: 239-365
Classification Level Classification E-value
Superfamily Cadherin-like 2.36e-30
Family Cadherin 0.0026
Further Details:      
 
Domain Number 2 Region: 454-578
Classification Level Classification E-value
Superfamily Cadherin-like 4e-30
Family Cadherin 0.0019
Further Details:      
 
Domain Number 3 Region: 132-243
Classification Level Classification E-value
Superfamily Cadherin-like 1.7e-21
Family Cadherin 0.0071
Further Details:      
 
Domain Number 4 Region: 352-457
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-20
Family Cadherin 0.0024
Further Details:      
 
Domain Number 5 Region: 568-673
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-17
Family Cadherin 0.0069
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000002403
Domain Number - Region: 34-103
Classification Level Classification E-value
Superfamily Cadherin-like 0.000271
Family Cadherin 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002403   Gene: ENSTNIG00000004362   Transcript: ENSTNIT00000003078
Sequence length 707
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:68683666:68688635:-1 gene:ENSTNIG00000004362 transcript:ENSTNIT00000003078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSLSLSKEPEPEQEKMQFWDTVFVLCAVWPAALSVTRYSIAEEMERGSVVANLAADLGLE
LGGLAQREVKLDIFHNKKYLDVNKKTGELFIVEKIDREFLCPKLTSCFLKLDVIIESPLR
IFNIELGITDINDNAPHFRRERVELDVSESASPATPRGERFSLSNAVDPDVGSNSVKTYY
LTESQYFNIEVQTGRDSSKFVELILKKALDREQQSVHNLILTAVDGGKPARSGTASVIVR
VLDTNDNSPTFDKSHYDLKIMENSPIGSLVIHLNATDLDEGSNADLTYSYSLYTSEKTQE
TFHLNPSTGEITVKGLLNYEDLKIYDMEVIATDKGANSLSGQCTIKVLVEDMNDNHPEIS
IKSFKTPVKENIDVETVIAVVSVSDKDSGDNGVVDLHIPDKMPFKLRQSSDNYYELVVSE
PLDREKVPEYDITFTVTDRGSPPLSDNETMTLELLDVNDNVPRFPQSFYTIRVTENNAPG
ALLSSLTAFDPDLHENQYLVYFILEKEIANTSMSMLFSINPENGNLYALKTFDYEIEKEF
LFHIEARDSGSPPLSSNVTVHIVIVDQNDNAPVIVSPWRAQGSVVEEKIPRSTDKGSLVA
KVIALDVDSVHNSRITYQLLQVTDATLFSLDQYNGEIRTMRMFSYRDPRHQRLVVVAKDN
GDPALSATVTIKLSTVETAVKAYSDMTEVPLGYDIFSDLNLYLVIGL
Download sequence
Identical sequences H3C2D5
ENSTNIP00000002403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]