SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002419 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002419
Domain Number 1 Region: 21-105
Classification Level Classification E-value
Superfamily vWA-like 0.000000000000334
Family Integrin A (or I) domain 0.0084
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000002419
Domain Number - Region: 122-228
Classification Level Classification E-value
Superfamily vWA-like 0.00779
Family Trunk domain of Sec23/24 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002419   Gene: ENSTNIG00000001486   Transcript: ENSTNIT00000001839
Sequence length 233
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:100399798:100401778:-1 gene:ENSTNIG00000001486 transcript:ENSTNIT00000001839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGFRYQDETHLTGRKPSEWFPAAGSRIDENVPQILIVVNGGKSADDFKTAVLGLKNKRVR
VYAVGVGNNESELQNLASEPTMVARASTVLELSENVEQILDTLEDEVRGNLCIKQQETPT
TCNIEVLVGFDVSAQNIFSAQPNLQSKMNSILQRISKMAAISCSSGQIPSVQVGILAMDS
AFEPAHLEFTDNADELFEAFSTLRSRGPFVLNGRTISAYTNRFKGRQNNAIKV
Download sequence
Identical sequences H3C2F1
ENSTNIP00000002419 99883.ENSTNIP00000002419 ENSTNIP00000002419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]