SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002427 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002427
Domain Number 1 Region: 3107-3418
Classification Level Classification E-value
Superfamily BEACH domain 2.49e-106
Family BEACH domain 0.000000129
Further Details:      
 
Domain Number 2 Region: 3531-3780
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.53e-32
Family WD40-repeat 0.0078
Further Details:      
 
Domain Number 3 Region: 3008-3111
Classification Level Classification E-value
Superfamily PH domain-like 4.24e-23
Family PreBEACH PH-like domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000002427
Domain Number - Region: 325-459,567-637,713-796
Classification Level Classification E-value
Superfamily ARM repeat 0.000921
Family GUN4-associated domain 0.074
Further Details:      
 
Domain Number - Region: 1517-1660
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0156
Family Clostridium neurotoxins, the second last domain 0.086
Further Details:      
 
Domain Number - Region: 253-272,402-451,2284-2370
Classification Level Classification E-value
Superfamily ARM repeat 0.0791
Family Armadillo repeat 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002427   Gene: ENSTNIG00000016659   Transcript: ENSTNIT00000003417
Sequence length 3797
Comment pep:known_by_projection chromosome:TETRAODON8:17:2020478:2045528:1 gene:ENSTNIG00000016659 transcript:ENSTNIT00000003417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGASNTLAREFLTDVHQLCSAVAQRAEAREEDEEESHMVALGEYLVRGRGFLLLSTLDS
IIDQELTCREELLTLLLSLLPLVWKSPVQEDKAPDFTLPSLLGIFLSRDVKSSPLREGQR
TAADEANSSKRPRLGSSAWKSRRSRRTAHKYSVKDARRWQLSTSDSEENPEGKASGGHGG
ASSRRLRGSTIRVSCQHHRSESFLTPPSATLAETPMSTPHLHPRAPGPQMTDMETLTDPA
AISIFNRMENSPFDLCHVLLSLLEKVCKFDLSLNHNPGLAVSVVPTLTEILAEFGECYAP
GGGGNGGGGAGMEEVARGWSEEPIALIQRMLLRTILHLMSVDISQSETLSDSLRRSLTDL
LRATLKIRSCLDRQTNPFAPRPKKTLREVQEDFSFSRYRHRALLLPELLEGVLQVLLSCL
QASTPNPFFFSQALELIHEFVQHCGLDLLETTVLRLEGLGKIRDPEIAGEATERLRGLIT
GVFKIISAVKKAKSEQLHQSVCARRRHRRCEYSHFLHHHRDLSGLPVSAFKQAARRNPFE
EDADGKAELEGYAARYPERCCCLAACAHQCLRLLQRLSPSGQAVLQVLAGVQAVGICCCM
DPRSVVGPLLHAFQAPALRGYQSNVLSVLGRLILDQLGGGQPSEKAKLASCNICTLDRSQ
LPGLEETLLHGHASSLSATLCYRSQGILPSGGGAEDMLWRWDALEAYQPLVFGEDWQLSQ
QIAAHVCHLTLRGNAVVQWQLYTHIFNPVLQRGVELAHHAQQLGVSTVCTQVCSYHTRCL
PVEILLVYLQTLPALLKSRVIRDLFLSCNGLNQVTELVYLDQTRSLALKVFETLIIGSGP
RQKGGALQELESTDAEGREAILGLAEELRSQGAAEGPQSLSKFYEGLKEKYPCYKNRSGE
ERGGGGGRGQAETHLHVINLFLCVAFLCVSKEADSDRDSANDSEDTSGYDSTASEPLGGR
LPYLSPDNIVLPSKEQVRRAADVWTVCKWIYLASPLFQRQFFKLGGLDVCLRLMAMVIQK
LSCKSKDGKPRKRREGKTKGSPESTAPAVEPEQEEASCESAETLGTGPAESKTKDPAKKL
EEEWQLQSIRLLEALLAICLHSSNSASLKMETELSYQLQSVEETLFEVRDQLSRSGVVNS
DLAVPLFDSLLRVALAQVSSSPDAPEEKPERKPQVLVEGAVQAGDLSEEVDEAQSGGSKP
LGEEEGYDADSESNPGEMAKQEEAISSGVKEDFAALRNLALAGDGSRRGVLRFPEICTMQ
LHLLSTGSPDLEVLEHVFHSLLAAVHANRRNAALLYDQGGVRTILSGFHRILSHTSPSFT
GCQTVLVELLVAMVSHRITAEELALLIRLFLEKTPPTEVLLKGLQHMVEANMSIEPLHLL
TFPVTLGAPRARRGVSFRQNGSAGGKSVGLLWKGKLSPGRGDGDGECRTSHFSSSPWHAA
PLHLPLVGQNCWPHMASGFSASMWLRVSEQDGDRNQGETPSFDALGNTSGALSLPEDGSP
PAAQPHHGASQAGTRPAEDGLTHIMSMGSKALMLQMWADFSTGSLTFRICIDPNDEMKAG
LLAQAESGEKLLNAGQWQHVGLTYTQQLEGKKNTHGRVVVWVCGIRKCEVSLVYSLPRKS
SLSSDSNKTFCMLGHCTQASGELGKQGRLWSLGTVLLFNGSRIGTEEALYLFTSGPDLTS
IMPCKYGKPAGIFTKFVTEDSLRSEHVRELFMKNKDVDTAALVESLAVVYAPSSPRDYTI
YEPVIRLKGQARTVVTQRPFSSKEVQSLSLEPSALSSLQPTETQGLQSVLHKIGGMGTFV
FLFARTVELSDCEKTQALALRVLLSLTKFNQHRIHEMDCCHGYSMIHQVLIKSKCIVGYH
VLKTLLDGCCSRPILLLGDDEQFRLDPDSVAVVQDIRLLSDVLLDWKIWAKAECGVWETL
LTALEILIRVHHPHQVFNIRQLLKAGVVHHFLLTWQVLQEHRDEHLTAIPQDVCLSFVRI
IQEVLGSPPDMDLLRLIYNFLLAVHPPTNTYVCHTPASFYFSLHLDGKLYREKVQSIMYL
RHSSSGGKSTSSSVVSLSPTVFNDAPHEGHLHAPSPEHGGDDQLLRPPSLAPSPYTSPLL
TPRLGHPNSSEAGESDRSSLAALQALGSTETLKKAGDEPLLSSCESAKTICDSKSDPKDA
GQGALRTPSISVEEERDDTAEVDSLADGSVGVAESEDRFDWATEETPRRPDSLKGIQSFQ
RSHSNLASLGLAFPAQNGSLAISRWPSAAERGSMPEDWESYTYSPGYERAHSKTETNERS
STEDCLVLICCGLYDLLRGILLLLPDLMLEEVMDKLIQPEALIVLVNHSSPLIQQGVMKL
LDAYFSRAHKEQKEKFLKNHGFSLLANQLYIHQGNQGLLECFLEMLFGHPVSLEEDLDLE
EMENISPFRKRCIIPVLGLIENSLYENSLAHSILCMLLQLVNACPKLADILLDHGLLYVL
FNTLSTLNGMETGIPLNDYKLLVCDIQQLLVAVTIHSCSSSGSQYFRIIEDLITLLGFMQ
TSKVGRTQEMAVALQFRVLQSAVEFIKSTANQEPPTLSSSATAPSSPHYGIYQKRRSIAG
RRRFSLAQSDSLLMRMRSLASDELSQMMQRRMSQENPIRASEAEFVQRLQKLVVLAVNRL
IYHDVSQDLFDLLNIPDSPDQQPLTPELCEAPPESGPASVPHSPVPFTLPPASKTSFQKD
ILKLMMDGIKLSLSSGRGPAPHHQWQKILWSCRDTFRVQIGRLLVHTLSPALPLSDRKEA
LEFVLDSRHLDILKESLSPSLEHGTKLSLYLHEMLHDHKDSLTKEEQRAVDVFATSLKLC
GHRCIPPNAAHKQDLLKALKEETFRYEAEEKTSKAAWEKKIVSTQRNLILRLDGKSKDIS
KIAADITQNVSLLQGMERKKVIQHIKGLYKTDLSASRHWQELVQQLTHDRAVWYDSSSYP
TSWQLDPTEGPNRERRRLQRCYLTIPNKYLLKDRRKPDDPAKAALSFLFEDKTHSSFSST
VKDKATSEPIRFTRRCISVAPSRETAGELLLGKSGMYFVEDNAADAHDSQSLHGETEAPS
FSWTYEEIKEVHKRWWQLRDNAVEIFLTNGRTLLLAFDNAKFRDDVYHNILTSDLPNLLE
HGNITALTQLWSSGQISNFEYLTHLNKHAGRSFNDLMQYPVFPFILRDYTSETLDLQDAG
IYRNLSKPIAVQSKEKEDRYVDNYRYLEEEYRKGVREDDPMPPVQPYHYGSHYSNSGTVL
HFLVRMPPFTKMFLAYQDQSFDIPDRTFHSMNTTWRLSSYESMTDVKELIPEFFYLPEFL
VNREGAVDFGVRQNGERVNHVNLPPWARNDPRLFVLIHRQALESEQVSQTLCQWIDLVFG
LKQKGKAAVQAINVFHPATYFGMDVSAVEDPVQRRALETMITYGQTPRQLFNGSHVSRAA
SRVLMEGELPAAMGLLVQLAFRETREPAKDVVCPSPLPWIRGLKWGEYVGSPCAPDPVVC
FSQPHGERFGSLLALPTRAVCGLSRKFCLMMIYSKEQGVRSMHSTDIQWSAILSWGYADN
ILRLKSKQSEPPINFIQCSQLHQVSSCAWVPDGCQLFTGSKCGVITAYSNRFTNTTPSEM
EVESQVHLYGHTAEVTSLFVCKPYSVLVSVSRDGTCILWDLNRLCYVQSLTGHKSPVTAV
SASETTGDIATVCDSVGGGSDLRLWTVNGDLIGHVHCREIICSVAFSNQPEGMSVNVIAG
GLENGVVRLWSTWDLKPVREITFSKSSKPIISLTYSCDGHHLYTANSEGTVMAWCRRDQQ
RMKLPMFYSFLSSYAAG
Download sequence
Identical sequences H3C2F9
ENSTNIP00000002427 99883.ENSTNIP00000002427 ENSTNIP00000002427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]