SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002430 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002430
Domain Number 1 Region: 75-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000134
Family Laminin-type module 0.0059
Further Details:      
 
Domain Number 2 Region: 24-72
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000474
Family Laminin-type module 0.00098
Further Details:      
 
Domain Number 3 Region: 123-168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000391
Family Laminin-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002430   Gene: ENSTNIG00000001408   Transcript: ENSTNIT00000001469
Sequence length 183
Comment pep:novel chromosome:TETRAODON8:4:5407721:5409027:1 gene:ENSTNIG00000001408 transcript:ENSTNIT00000001469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGAHGGPPLRTLPAGTGKNDKPCSCNPVGTSGDVNECHPQTGHCRCLSHVTGRDCGSCE
VGFFNLQPGVGCERCQCNPIGSSSLACHPVTGQCVCRAGVEGRLCDSCRMGFFGFSSRGC
RACNCDPMGSLSMQCHNNGTCRCRQGFVGYNCDKCELNYFQSRATHQCEECPVCYSLVKK
QVS
Download sequence
Identical sequences H3C2G2
ENSTNIP00000002430 ENSTNIP00000002430 99883.ENSTNIP00000002430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]