SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002443 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002443
Domain Number 1 Region: 387-530
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.42e-17
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 345-395
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000133
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 3 Region: 303-360
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000664
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 4 Region: 244-332
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000144
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 5 Region: 182-235
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000243
Family EGF-type module 0.026
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000002443
Domain Number - Region: 517-555
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000838
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002443   Gene: ENSTNIG00000006788   Transcript: ENSTNIT00000003872
Sequence length 699
Comment pep:known_by_projection chromosome:TETRAODON8:19:5365637:5371388:-1 gene:ENSTNIG00000006788 transcript:ENSTNIT00000003872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNEAVSHALVPAHKPVINLWDMQRLLIARSNFEETVDECCQDGRNRGNNGHDCTIIPAFS
SSYTCRIAQEQCCSAAKETHLCLNGVIMALGQGACEVPYFEGEPWEAKLSKICCDCCTLG
LMTARDTSSCNFNHLLLNSQCSDTAKACCINKTMEELQTGPVLAQPKVNDTANPSVDCTV
RGNSPCSHFCLDNNTCGCFRGFQLQNDGVNCEDINECLAGTHNCFGNLVCINTEGSFLCQ
RRSNCGSGFELKFDNTCQDLDECILGIHNCGADHLCVNTPGSFQCYPGNTCPAGFTEDAA
DSCTDVNECVAHSSPCLPGETCVNTEGSFVCRKNTVTCGRGYHLSQDGTRCEDVNECQTG
NVCGNHSCFNLVGAYRCECRKGFFFNDGTKRCEDVNECRYYQGLCAHNCENTVGSYRCSC
AAGFQLSYDGVNCEDVDECLARPCGQNCANVYGSYRCYCHHGYQLSDTDRMTCEDVDECA
QRSGGHTCSYSCSNVPGSYYCTCPPTGYILAPNGQTCLDIDECAAGIHTCSATDSCFNIQ
GGFRCLSFSCPANFYEVARGSRDDPSVSLRCMKHCHPNNLACNLEPVHLITYTCLSLPTF
RDLTQPEDIIYLQTSTAFKTSTRHHATDIFFEILSADVQSFEAQKRAHQGMIIGVIQQVK
PIIGPADLVLQVAINYVQSGVISHRNIVFIHIFISDHLG
Download sequence
Identical sequences H3C2H5
99883.ENSTNIP00000002443 ENSTNIP00000002443 ENSTNIP00000002443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]