SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002451 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002451
Domain Number 1 Region: 14-242
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.76e-72
Family BAR domain 0.0000000207
Further Details:      
 
Domain Number 2 Region: 286-357
Classification Level Classification E-value
Superfamily SH3-domain 6.3e-23
Family SH3-domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002451   Gene: ENSTNIG00000011037   Transcript: ENSTNIT00000001575
Sequence length 362
Comment pep:known_by_projection chromosome:TETRAODON8:18:7319611:7332147:1 gene:ENSTNIG00000011037 transcript:ENSTNIT00000001575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAGLKKQFHKATQQKVSEKVGGAEGTKLDDDFTEMEKRVDVTSRAVLDIMTKTTEYLQ
PNPATRAKMSMMNSMSRMRGQEKGPGYTQTEAILGESMQKFGRELGEESSFGLALVDIGE
AMRDGEVKDALDMEVKQNFIDPLQNLHEKDLKEIQHHLKKLEGRRLDFDYKKKRQAKVTE
DELKQALEKFDDSKEIAEQSMFNLLESDIEQVSQLAALVQAQLEYHSRSAEILTQLSSKI
DERIREASGKPRKEFVPKPRTSLDFSISENHNGGIHGARSPVISGARSPARSPARSPAPM
DQPCCRALYDFDPENDGELGFKEGDIITLTNKIDDNWFEGMLHGNSGFFPINYVDTLVPL
PH
Download sequence
Identical sequences H3C2I3
ENSTNIP00000002451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]