SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002469 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002469
Domain Number 1 Region: 159-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000402
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 2 Region: 1-29
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000111
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 3 Region: 120-163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000167
Family EGF-type module 0.021
Further Details:      
 
Domain Number 4 Region: 76-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000178
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002469   Gene: ENSTNIG00000000773   Transcript: ENSTNIT00000000539
Sequence length 205
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:70730201:70733064:1 gene:ENSTNIG00000000773 transcript:ENSTNIT00000000539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSSNPCRNGGTCLNLLNSYHCLCPSNWEQYCLNKHHKRLKDCLQAMSLPCPSTSLDSRTG
SLGSPGGAGGPDCATDVNECQLFSGKAQGCQNGATCVNGPGSFTCTCSPEWSGSLCTVRY
DDCRNAAQDLCVHGTCIDAAPGYICICNSGWQGVNCEQNINECASSPCLNGGTCSDGVNG
FTCSCTAQWTGPLCQTPQQGMMGFI
Download sequence
Identical sequences H3C2K1
ENSTNIP00000002469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]