SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002487 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002487
Domain Number 1 Region: 26-125
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.51e-16
Family Ankyrin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002487   Gene: ENSTNIG00000000324   Transcript: ENSTNIT00000003396
Sequence length 355
Comment pep:known_by_projection chromosome:TETRAODON8:4:1681191:1682579:-1 gene:ENSTNIG00000000324 transcript:ENSTNIT00000003396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALVSMLCRKQKRVWRYVEDGRLLSLKAFLRRHRDLDVNFSRGRRKRSPLHLACHRRHDAV
LRLLLKHGADVLRRDREGNTPLHVAVKRALKAYDDLVVPLKNSCPEALNAANNAGVTPED
LLTKMKHKKRTEDESGSGADPQAEWIHKLWDEIDDEFCESSGIYHGKYDYVDDDEGDFGH
WADRIRREYFDKKHAEAQRRAAVSSGGKQKKSKQEADGGVESIKKLQKEHEEYLKRGARK
EEELRQAKKRRYEEGCAATFRPGPSAGSAKLSYGHIPWPAPRGTVQEMLDVMLHGVDRKD
LPTFRKVLRKQQALWHPDKFAQRCEARLEEKDRQRILDTVTALSQGLNSLAQRLK
Download sequence
Identical sequences H3C2L9
ENSTNIP00000002487 ENSTNIP00000002487 99883.ENSTNIP00000002487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]