SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002488 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002488
Domain Number 1 Region: 30-263
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.88e-80
Family Calponin-homology domain, CH-domain 0.0000923
Further Details:      
 
Domain Number 2 Region: 1260-1374
Classification Level Classification E-value
Superfamily E set domains 7.34e-36
Family Filamin repeat (rod domain) 0.0000313
Further Details:      
 
Domain Number 3 Region: 1449-1565
Classification Level Classification E-value
Superfamily E set domains 3.69e-34
Family Filamin repeat (rod domain) 0.0000073
Further Details:      
 
Domain Number 4 Region: 456-573
Classification Level Classification E-value
Superfamily E set domains 6.01e-32
Family Filamin repeat (rod domain) 0.00064
Further Details:      
 
Domain Number 5 Region: 1374-1483
Classification Level Classification E-value
Superfamily E set domains 8.41e-32
Family Filamin repeat (rod domain) 0.000024
Further Details:      
 
Domain Number 6 Region: 1170-1282
Classification Level Classification E-value
Superfamily E set domains 5.67e-30
Family Filamin repeat (rod domain) 0.0000171
Further Details:      
 
Domain Number 7 Region: 1772-1866
Classification Level Classification E-value
Superfamily E set domains 1.07e-29
Family Filamin repeat (rod domain) 0.00000903
Further Details:      
 
Domain Number 8 Region: 1557-1662
Classification Level Classification E-value
Superfamily E set domains 2.4e-29
Family Filamin repeat (rod domain) 0.0000541
Further Details:      
 
Domain Number 9 Region: 854-972
Classification Level Classification E-value
Superfamily E set domains 3.57e-29
Family Filamin repeat (rod domain) 0.00028
Further Details:      
 
Domain Number 10 Region: 1090-1194
Classification Level Classification E-value
Superfamily E set domains 5.47e-29
Family Filamin repeat (rod domain) 0.0000747
Further Details:      
 
Domain Number 11 Region: 672-780
Classification Level Classification E-value
Superfamily E set domains 1.08e-28
Family Filamin repeat (rod domain) 0.00041
Further Details:      
 
Domain Number 12 Region: 2148-2241
Classification Level Classification E-value
Superfamily E set domains 8.67e-27
Family Filamin repeat (rod domain) 0.00000589
Further Details:      
 
Domain Number 13 Region: 379-478
Classification Level Classification E-value
Superfamily E set domains 7.64e-26
Family Filamin repeat (rod domain) 0.00094
Further Details:      
 
Domain Number 14 Region: 1954-2050
Classification Level Classification E-value
Superfamily E set domains 1.34e-25
Family Filamin repeat (rod domain) 0.0000208
Further Details:      
 
Domain Number 15 Region: 564-666
Classification Level Classification E-value
Superfamily E set domains 3.07e-25
Family Filamin repeat (rod domain) 0.00012
Further Details:      
 
Domain Number 16 Region: 278-373
Classification Level Classification E-value
Superfamily E set domains 1.73e-24
Family Filamin repeat (rod domain) 0.0014
Further Details:      
 
Domain Number 17 Region: 2339-2429
Classification Level Classification E-value
Superfamily E set domains 4.87e-24
Family Filamin repeat (rod domain) 0.0000163
Further Details:      
 
Domain Number 18 Region: 2246-2336
Classification Level Classification E-value
Superfamily E set domains 1e-23
Family Filamin repeat (rod domain) 0.0000183
Further Details:      
 
Domain Number 19 Region: 768-871
Classification Level Classification E-value
Superfamily E set domains 3.83e-22
Family Filamin repeat (rod domain) 0.00087
Further Details:      
 
Domain Number 20 Region: 2466-2559
Classification Level Classification E-value
Superfamily E set domains 2.07e-21
Family Filamin repeat (rod domain) 0.000017
Further Details:      
 
Domain Number 21 Region: 2068-2162
Classification Level Classification E-value
Superfamily E set domains 4.2e-21
Family Filamin repeat (rod domain) 0.0000312
Further Details:      
 
Domain Number 22 Region: 959-1067
Classification Level Classification E-value
Superfamily E set domains 2.74e-19
Family Filamin repeat (rod domain) 0.0024
Further Details:      
 
Domain Number 23 Region: 1868-1952
Classification Level Classification E-value
Superfamily E set domains 6.01e-17
Family Filamin repeat (rod domain) 0.0000525
Further Details:      
 
Domain Number 24 Region: 1708-1786
Classification Level Classification E-value
Superfamily E set domains 1.8e-16
Family Filamin repeat (rod domain) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002488   Gene: ENSTNIG00000004951   Transcript: ENSTNIT00000002466
Sequence length 2559
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:73165184:73184635:-1 gene:ENSTNIG00000004951 transcript:ENSTNIT00000002466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSHPRLHQSAAPAPNTLSSDKDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCVN
KRIANLQTDLSDGLRLIGLLEVLSQKKFRKYNQRPTFRQMQLENVSVALEFLDRENIKLV
SIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEEADDGKQKTPKQRLLGWIQNKLP
ELPITNFNRDWQTGQALGALVDSCAPGLCPDWDQWDQSKPVDNAREAMQQADDWLGIPQV
ITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGVEPVGNVVMKK
TVFTVETISAGMGEVLVYVEDPAGHREEAKVTANNDKNRTYSVFYTPRVTGMHKVTVLFA
GQHISKSPFEVEIGMAQGDSSKATAQGPGLEPSGNIANKTTYFDVYTAGAGVGEVEVIIM
DPSGKNSTVKCNIEDKGNNSYRCTYKPTQEGQHIISVTFAGGQISRSPFTVSVGEACNPN
LCRAKGRGLQPKGLRVKETADFKVYTKGAGTGELKVSIKGPKGLEEPCKRKDLGDGVYGF
EYYPTSPGTYSITITWGGQHIPRSPIEVKISPEAGQQKVRAWGPGLEGGVVGKSADFVVE
AVGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVLCNNEDIQHSPFM
AEIVTPPSKDFYPDKVKAFGPGLQSSGLAVGKPTEFTVDAKHGGKAPLKIVAQDGEGVPV
DVQVKDNGNGTYSCSYTPRKPVKHTAMISWGGVNIPDSPFRMNIGAGCHPNKVKVSGPGV
AKSGLKAFEPTYFTVDCSEAGQGDISIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYT
PPGAGSYTIMVLFADQAIPMTPIRIKVDPAHDASKVKAEGPGLSRTGVELNKPTHFTVST
KGAGKANLDCTFSGPTKVEAAKDVEVINNHDNTHTVKYTPVQQGPLGIGVTYGGDHVPKS
PFTVTVAPTLDLSKISVAGLGEKMTVGKDQDIIIKTKGAGGQGKVGAKVTAPSGKPVASK
VEPGLSPETSQVKFIPREAGPYQVELTYDGVPIPGSPFSPTAYSASDPSKVGRPRRQKDL
HVLNNNTSPQVRCSGPGLERARVGEKGEFFVDCTNAGPADLTIEIISDSGTEAEVHIQDN
GDGTYTITYIPLYPGSYTLTIRYGGQDVPNFPARLNVEPAVDASGVRVFGPGVESKGVFR
EATTDFTVDARALAPNGGDHIKTLISNPSGSCTDALISDLGDGTYSVAYTPYEEGPHSVE
VCYDGMPVPKSPFHVAVTEGCNPGRVRVHGPGLKGGTTNKPNKFTIETRGAGTGGLGLAM
EGPSEAKMSCIDNKDGSCSVEYVPYEPGTYNLNITYGGQPITGSPFSVPVSDTVDSTKVK
CQGPGLGNNVRANIPQAFTVDASKAGVAPLQVRVQGPKGVVEPVEVVDNGDQTHTVNYVP
TREGPYSINVLYDDEEIPRSPYKVKVLPTHDASKVRASGPGLNTTGVPASLPVEFTIDAK
DAGEGLLAVQITDPEGKPKKANIRDNHDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYR
IRALPTGDASKCTVTGAGIGPTIQIGEQTVITVDAKAAGKGKVTCSVCTPEGAELDVDVV
ENEDGTFDIFYTAPQPGEYVICVRFGGEHIPNSPFQVTALEGAPSQQLLQQSQVPQYYAP
QSWATDRPMGMNGLDVAGLRPFDLVIPFTIQKGEITGEVRMPSGKVAKPDITDNKDGTVT
VKYAPTEAGLHEMDIKYEGIHIPGSPLQFFVDYINSGNVSAYGPGLIHGTVNKPAVFTVD
TKDAGEGGLSLAIEGPSKADISCVDNQDGTCTVSYLPVLPGDYSILVKYNDKHIPGSPFS
ARITGDDSMRMSHLKVGSAADIPLDIGELDLTQLTASLTTPSGREEPCLLKMLRNGHVGI
SFVPKEIGEHLVNIKKNGRHIPNSPISVMIRESEIGDASRVRVSGQGLSEARTFEPAEFI
IDTRDAGYGGLSLSIEGPSKVDINTEDQEDGTCKVTYCPTEPGNYIINIKFADQHVPAGS
AFTVKVTGEGRMKESITRKRRAPSVANVGSQCDLSLKIPEINMAEMTAQVTSPSGQRHKA
DIMEGENNTYCIRFVPTETGVHTVSVKYQGSHVPGSPFQFTVGPLGEGGAHKVRAGGPGL
ERAEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSSGVSYIVQEPGDYEVS
IRFNDEHIPDSPFIVPVASPSDDARRLTVASLQESGLKVNQPASFAVSLNGAKGMIDAKV
HSPSGALEECCITEIDQDKYAVRFIPRENGLYLIDVKFNGSHIPGSPFKIRVGETGQAGD
PGMVSAYGAGLEGGSTGSACEFLVNTSKAGPGALAVTIDGPSKVKMDCVECPEGYRVTYT
PMAPGSYLISIKYGGPYHIVGSPFKARISGSKLVSSHSAHETSSVTVDPVTRAISCSPAG
ASSQSDASKVLAKGLGLSKAYLGQKNSFSVDCSKAVFTGRNMLLVGVDGPKVPCEEILVK
HLGNRMYNVSYQLKEKGEYILVVKWGDEHIPGSPYHITV
Download sequence
Identical sequences H3C2M0
ENSTNIP00000002488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]