SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002536 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002536
Domain Number 1 Region: 40-96
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000377
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 2 Region: 12-50
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000156
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002536   Gene: ENSTNIG00000000428   Transcript: ENSTNIT00000003084
Sequence length 249
Comment pep:known_by_projection chromosome:TETRAODON8:13:13176573:13178045:-1 gene:ENSTNIG00000000428 transcript:ENSTNIT00000003084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGTGGDPPSIQPSRCTHVRGSTRCTCPAGFTISGRDNNLCTDMDECRVFPPGRLCVHGCT
NSPGSFRCFCPAGYHLAADGSSCTDVDECEHGSHTCGAEHLCVNTFGGFQCVTVGCPNRR
NATYIRTTPTRCERNPCLQGDQSCLQAPNSISFQFLSVVSNVSTPRVLFRVSAARVLGDT
LRFALVGGRSHGCFSLQRSGRQTGTLLLVVPVRGPSTLEAEVEMSELEGPALLGRYVTKV
TLFVSAFDF
Download sequence
Identical sequences H3C2R8
ENSTNIP00000002536 99883.ENSTNIP00000002536 ENSTNIP00000002536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]