SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002538 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002538
Domain Number 1 Region: 562-682
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.42e-26
Family Protein kinases, catalytic subunit 0.0000794
Further Details:      
 
Domain Number 2 Region: 56-130
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000186
Family Cadherin 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002538   Gene: ENSTNIG00000013085   Transcript: ENSTNIT00000001310
Sequence length 706
Comment pep:novel chromosome:TETRAODON8:17:973768:977564:1 gene:ENSTNIG00000013085 transcript:ENSTNIT00000001310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RITLDFVNAMMPQCGETDLKELCFPRKDTSNPHITENRFPGGLRQLRRLSWLNVCPNYTI
SYSVETESPAPFAVNENTTELVVTAPLDREESESYRLLLVCTVRTEAVITKVETSLDVFV
DDEDDNAPYMNGTDTADIVISFNRTAGGSFGTLSVFDRDLTPIIDRTHNKYVGTLLNIDP
WVKETFDIKGTFSEKKAAQGGIRETVHDYHLVLKRNLYVTENRTLQLDYLVNDTTYPGLE
GTVLLHFNVTILPVHIFFSNITHTFPLTRRASSYAQVGKVCVENCRQFDGFRIAYRLELP
DKNVSADVLSCHSAVSIAQAPDEMWGLLYVNDTEELRRPECQDLQYLVVVKEQHTQMETS
VQIQIILDNEVCSTKVGQESQPLLSCAENRRRGDCESARGLGTTTGRCQWRQGSDKGISK
NYSTCSPDLRTCPDSVCDAVESKDASICPQDCTKKTVIGGHEPGLRNGIQAGHGTCYCYS
EKCFCEKEDIDETMCDDMCKTIIATALLLSFIVSILLSSYFIHRYHKNSPKPPIASAEMT
FRRPAQAYPISFPANNLRRGSQESIETDTFKIPEDPKWEFPRKNLVLGKTLGEGEFGKVV
KATAFRLKGKAGYTTVAVKMLKENASHSELRDLLSEFTLLKQVNHPHVIKMYGACSQDGP
LYLIVEYAKYGSLRNFLRESRKVGPSYMGRDANRNSSCLAGPLECY
Download sequence
Identical sequences H3C2S0
ENSTNIP00000002538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]