SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002556 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002556
Domain Number 1 Region: 218-341
Classification Level Classification E-value
Superfamily Cadherin-like 1.7e-32
Family Cadherin 0.00039
Further Details:      
 
Domain Number 2 Region: 430-556
Classification Level Classification E-value
Superfamily Cadherin-like 1.07e-31
Family Cadherin 0.0011
Further Details:      
 
Domain Number 3 Region: 330-434
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-23
Family Cadherin 0.0033
Further Details:      
 
Domain Number 4 Region: 115-222
Classification Level Classification E-value
Superfamily Cadherin-like 4.19e-22
Family Cadherin 0.0045
Further Details:      
 
Domain Number 5 Region: 546-655
Classification Level Classification E-value
Superfamily Cadherin-like 9.85e-16
Family Cadherin 0.0064
Further Details:      
 
Domain Number 6 Region: 18-98
Classification Level Classification E-value
Superfamily Cadherin-like 0.00007
Family Cadherin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002556   Gene: ENSTNIG00000001476   Transcript: ENSTNIT00000001702
Sequence length 719
Comment pep:novel chromosome:TETRAODON8:1:6711620:6717255:1 gene:ENSTNIG00000001476 transcript:ENSTNIT00000001702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQILLILLYLVCNVGCQIRYSIPEEMKKGSLVGNIASDLGINVQRLRSGRARIVTGENS
QYAELKADKGMFVVNERVDREKLCGDMTPCSFSFDLILENPMELHHITVEVLDMNDNSPF
FHQHDMQLTIGESAAPGARFVLPTANDPDVGVNGLQEYYLSPNDNFVLKTHSNSDGRKYA
EMVLEKPLDRERHPNLSLKLIAVDGGTPQKSGTVNIEIFVLDANDNSPVFNQTVYKASVR
EHAPKGTYIITVNATDADSGSNGLIYYSFSKIDRSHGSGNLFMIDEKSGVIVIKGSVDYE
KDKKHELRIDAKDQGGLTDSCKVIIEVTDVNDNAPTITVMSFSSSVSEDSPPGTTIGIIN
VKDLDSGDNGQVNCRIEQNTPFKIKSNLKTYYTLVTDALLDRESVSDYNITVIASDAGTP
ALSTKKNFNIKISDVNDNAPVFPQAVYSAYVVENNSPGVSVLTLRAKDPDENQNARISYI
LEDTDIGASPISEYISVNAESGVIHAVKSFDYEQIKQLVFMVRAQDGGSPPLSSNVSVRI
LIQDQNDNPPQVLYPVQTGGSMVAEMVPRSADVGYLVTKVVAVDVDSGQNAWLSYKLQKA
TDRALFEVGLQNGEIRTVRQVSDKDAVKQRLSVIVEDNGQPSRSATVIVNVAVADSFPEV
LSEFTDFAQDKEYNDNLTFYLVLALAVVSFLFITCLVVIVSVKIYRWRQSRILYHSSLP
Download sequence
Identical sequences H3C2T8
ENSTNIP00000002556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]