SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002561 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002561
Domain Number 1 Region: 3-172
Classification Level Classification E-value
Superfamily E set domains 2.1e-68
Family Arrestin/Vps26-like 0.00000178
Further Details:      
 
Domain Number 2 Region: 176-354
Classification Level Classification E-value
Superfamily E set domains 1.77e-50
Family Arrestin/Vps26-like 0.00000225
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002561   Gene: ENSTNIG00000006323   Transcript: ENSTNIT00000002949
Sequence length 362
Comment pep:known_by_projection chromosome:TETRAODON8:7:10306680:10310507:1 gene:ENSTNIG00000006323 transcript:ENSTNIT00000002949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKVFKKTSGNGGLTLYLGKRDYVDNVNVVDKVEGVVKLDPKDFGDRKVFVQLACAFRYG
SEDLDVMGLCFRKDIWFECIQLYPESHKPSLGAMHETLLKKAGDNAYPFTFEIPNNLPCS
VSLQPGPDDKGKACGVDFEVKTYLAKEKSNPDEKIEKKDTARLIIRKIQYAPTQVGAGPK
ADVCKNFMMSDKPVHIEASLEKDLYFHGEAIPIKIKIQNESNKTVKKFKVTVDQTTDIVL
YSADKYTKTVLNKEFGETVEPNGTYENTLSITPMLNENKEKRGLALDGRLKDEDTNLAST
TMLRQGIEKEVLGILVSYKIKINLIVAGGGLLGGLTASDVTVELPLMLMHPKPEEVSSCS
IL
Download sequence
Identical sequences H3C2U3
ENSTNIP00000002561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]