SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002564 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002564
Domain Number 1 Region: 1382-1494
Classification Level Classification E-value
Superfamily C-type lectin-like 1.53e-42
Family Noncollagenous (NC1) domain of collagen IV 0.00000294
Further Details:      
 
Domain Number 2 Region: 1275-1381
Classification Level Classification E-value
Superfamily C-type lectin-like 1.74e-42
Family Noncollagenous (NC1) domain of collagen IV 0.00000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002564   Gene: ENSTNIG00000013921   Transcript: ENSTNIT00000000154
Sequence length 1495
Comment pep:known_by_projection chromosome:TETRAODON8:2:11764692:11777093:-1 gene:ENSTNIG00000013921 transcript:ENSTNIT00000000154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQGDFGLPGTTGLPGPPGLPGLQGNRGFYGPKFPHQGPPGDPGPRGQKGTMVKVLKGVKG
EQGEIGPMGPPGNSTYQQNRSPYGPPGFQGQKGLKGEPGDRADNKGETGMVGFSGPRGPS
GANGSAGIRGDLGDPGPRGRDGPKGDRGEPEDRWPGSTAGGRGVTVCAFYSNVGTTGTKG
GRGNRGVGGKVGAMGVEGIKGIKVWDLLGPFGFPGEEGDKGSRGEPGRPALFAGPEGSPG
RQGSPGPPGPKGTWSEWFKGAPGGRGRPGSAGFKGPKGSLSCWSLEGDHGQCECAIVNAP
PGPPGPAGDQGDAGMTGEFGKRGDVGDPGPQGEDGFSGPNGLIGQPGPKGQKGEQLVVKE
KGFQGESGDPGLSGEPGKAGAPGSNGVPGFPGSRGFQGEATQGHQGEKGFPGLSGQPGVA
GLRGEPGQDFIGVKGQRGLPGDAGFTGYEGVPGTPGSPGPCNAVPGPRGPPGPSGSNGLP
GIPGPLGEKGFKGQPGARGEKGELGEQGIGGQPGLPGFPGPRGDPGFSGIRGSEGVPGSD
GITGQQGLKGEKGAHGEVLGASPGPPGDLGLPGIRGNKGPRGDPGTQGYEGMSGVPGMIG
SKGEQGPLGLQGEQGRPGPPGVYGYPGDPGRAGPPGPLGAVGQPGFTGERGTEGDAGSPG
PVGLKGTLGAYGEIGPIGESGPTGDPGLPGPDGQPGVPGMKGYKGSPGMSGFEGMRGEAG
VKGWSGQQGISGGFGQTGPKGLPGVKGQKGDRGLGGPPGEKPHISPVMIIHMKGNKGEPG
YQGYQGFPGPRGAKGFHGVPGHGGLHGLPGDPNNVKGHRGDLGAQGLPGIRGMPGVSGKR
GISGFKGMQGPKGIKGSTGAYGASGELGIKGTKGEKGQQIDLPGSTGFRGELGLPGDPGA
KGQKGFTGTVGERGSPGFEGIQGKKGESGNSGIPGFAGVDGQKGTPGNQGQRGSPGIPGI
DGHPGLPGYPGNTDEKNIQIRTGFPGLKGLYGLHGLKGQKGLQGPPGLEIMGPTGDPGGK
GPKGDGGERNDQQGSPGSLGLKGFQGPQGDPGDPGLPGPRGLTGFDATPGPKVTKGFPGT
RGLPGLDGVHGEKGVPGISGFPGPVGLKGSKGGQGSFGYRGPDGVYGKKAGVKGEQGLMG
VPGVTGVQGDRGSTGPKGNVGATGFQGPPGNQGPRPFPPKIPGEKGSQGPWGTPGPHGVK
GQMGPQGFPGDAGLMGPRGQKGMPGINGRPGVPGFRGDVGQRGHAGLQGMEGSRGRPGAS
GLPGMPGRSVSVGYLLVKHSQTEQIPMCPVGMAKLWSGYSLLYMEGQEKAHNQDLGLAGS
CLPRFSTMPFLYCNPGDICYYASRNDKSYWLSTTAPLPMMPVEDVEIKPYISRCSVCEAP
SVAIAVHSQDITIPQCPVGWRSLWIGYSFLMHTAAGNEGGGQSLSSPGSCLEDFRTTPFI
ECNGAKGTCHYFANKHSFWLSSVDKSFHTEPKAETLKAGQLLLRIGRCQVCMKNL
Download sequence
Identical sequences H3C2U6
ENSTNIP00000002564 ENSTNIP00000002564 99883.ENSTNIP00000002564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]