SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002577 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002577
Domain Number 1 Region: 57-161
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.77e-34
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 2 Region: 232-288
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000256
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 3 Region: 294-349
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000292
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 166-227
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000085
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 5 Region: 4-50
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000113
Family Complement control module/SCR domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002577   Gene: ENSTNIG00000001199   Transcript: ENSTNIT00000002150
Sequence length 349
Comment pep:novel chromosome:TETRAODON8:8:3808674:3822593:1 gene:ENSTNIG00000001199 transcript:ENSTNIT00000002150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTTNNPLISIGATVQFSCDEDHVLQGSKTITCQRVAEVFAAWSDHRPACKVPCFSNFTAP
MGTVLSPDYPEGYGNNLNCVWLIISESGTRIHLAFNDFDLEPPYDFLTIKDGDQSGAALL
GRFSGAEVPSHLTSNSNVLQLEFQADHSMSGRGFNITYSTFGRNECPDPGIPLNARRFGD
SFQLGSSISVVCEEGFIKTQGADTITCHLEEGKVMWSGLIPKCEVVTLDTYSCMDPGIPV
NGARSNTDLSIGSTVSFQCDPGYRLSHEEPLVCEKNHFWSHPLPSCDEYDLEPCQNPGTP
RFGWHTGSRFGIGDSVSFSCNRGYRLQGAKKIVCLGGGRRMWSAPLPRC
Download sequence
Identical sequences H3C2V9
ENSTNIP00000002577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]