SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002633 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002633
Domain Number 1 Region: 128-221
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.57e-33
Family TATA-box binding protein (TBP), C-terminal domain 0.0000029
Further Details:      
 
Domain Number 2 Region: 216-304
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 4.71e-30
Family TATA-box binding protein (TBP), C-terminal domain 0.00000669
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002633   Gene: ENSTNIG00000017681   Transcript: ENSTNIT00000003628
Sequence length 306
Comment pep:known_by_projection chromosome:TETRAODON8:5:3657252:3659453:1 gene:ENSTNIG00000017681 transcript:ENSTNIT00000003628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQNNSIPGFQGLASPQGAMTPGMPIFSPMMPYGSGLTPQPVQNTNSLSILEAQQAQQAG
TGTALFILFSSKEFLEHQAQTPQLFHSQAVTGTTTTALPGNTPPLYNAPLTPMTPITPAT
PASESSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALI
FSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVRFPIRLEGL
VLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILK
GFRKTT
Download sequence
Identical sequences H3C315
99883.ENSTNIP00000002633 ENSTNIP00000002633 ENSTNIP00000002633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]