SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002671 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002671
Domain Number 1 Region: 3090-3401
Classification Level Classification E-value
Superfamily BEACH domain 2.49e-106
Family BEACH domain 0.000000129
Further Details:      
 
Domain Number 2 Region: 3514-3763
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.53e-32
Family WD40-repeat 0.0078
Further Details:      
 
Domain Number 3 Region: 2991-3094
Classification Level Classification E-value
Superfamily PH domain-like 4.24e-23
Family PreBEACH PH-like domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000002671
Domain Number - Region: 325-459,567-637,713-796
Classification Level Classification E-value
Superfamily ARM repeat 0.000785
Family Armadillo repeat 0.075
Further Details:      
 
Domain Number - Region: 1513-1656
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0156
Family Clostridium neurotoxins, the second last domain 0.086
Further Details:      
 
Domain Number - Region: 2293-2353,2405-2448
Classification Level Classification E-value
Superfamily ARM repeat 0.0537
Family Armadillo repeat 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002671   Gene: ENSTNIG00000016659   Transcript: ENSTNIT00000000208
Sequence length 3780
Comment pep:known_by_projection chromosome:TETRAODON8:17:2020478:2045528:1 gene:ENSTNIG00000016659 transcript:ENSTNIT00000000208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGASNTLAREFLTDVHQLCSAVAQRAEAREEDEEESHMVALGEYLVRGRGFLLLSTLDS
IIDQELTCREELLTLLLSLLPLVWKSPVQEDKAPDFTLPSLLGIFLSRDVKSSPLREGQR
TAADEANSSKRPRLGSSAWKSRRSRRTAHKYSVKDARRWQLSTSDSEENPEGKASGGHGG
ASSRRLRGSTIRVSCQHHRSESFLTPPSATLAETPMSTPHLHPRAPGPQMTDMETLTDPA
AISIFNRMENSPFDLCHVLLSLLEKVCKFDLSLNHNPGLAVSVVPTLTEILAEFGECYAP
GGGGNGGGGAGMEEVARGWSEEPIALIQRMLLRTILHLMSVDISQSETLSDSLRRSLTDL
LRATLKIRSCLDRQTNPFAPRPKKTLREVQEDFSFSRYRHRALLLPELLEGVLQVLLSCL
QASTPNPFFFSQALELIHEFVQHCGLDLLETTVLRLEGLGKIRDPEIAGEATERLRGLIT
GVFKIISAVKKAKSEQLHQSVCARRRHRRCEYSHFLHHHRDLSGLPVSAFKQAARRNPFE
EDADGKAELEGYAARYPERCCCLAACAHQCLRLLQRLSPSGQAVLQVLAGVQAVGICCCM
DPRSVVGPLLHAFQAPALRGYQSNVLSVLGRLILDQLGGGQPSEKAKLASCNICTLDRSQ
LPGLEETLLHGHASSLSATLCYRSQGILPSGGGAEDMLWRWDALEAYQPLVFGEDWQLSQ
QIAAHVCHLTLRGNAVVQWQLYTHIFNPVLQRGVELAHHAQQLGVSTVCTQVCSYHTRCL
PVEILLVYLQTLPALLKSRVIRDLFLSCNGLNQVTELVYLDQTRSLALKVFETLIIGSGP
RQKGGALQELESTDAEGREAILGLAEELRSQGAAEGPQSLSKFYEGLKEKYPCYKNRSGE
ERGGGGGRGQAETHLHVINLFLCVAFLCVSKEADSDRDSANDSEDTSGYDSTASEPLGGR
LPYLSPDNIVLPSKEQVRRAADVWTVCKWIYLASPLFQRQFFKLGGLDVCLRLMAMVIQK
LSCKSKDGKPRKRREGKTKGSPESTAPAVEPEQEEASCESAETLGTGPAESKTKDPAKKL
EEEWQLQSIRLLEALLAICLHSSNSASLKMETELSYQLQSVEETLFEVRDQLSRSGVVNS
DLAVPLFDSLLRVALAQVSSSPDAPEEKPERKPQVLVEGAVQAGDLSEEVDEAQSGGSKP
LEEEEGYDADSESNPGEMAKQEEGVKEDFAALRNLALAGDGSRRGVLRFPEICTMQLHLL
STGSPDLEVLEHVFHSLLAAVHANRRNAALLYDQGGVRTILSGFHRILSHTSPSFTGCQT
VLVELLVAMVSHRITAEELALLIRLFLEKTPPTEVLLKGLQHMVEANMSIEPLHLLTFPV
TLGAPRARRGVSFRQNGSAGGKSVGLLWKGKLSPGRGDGDGECRTSHFSSSPWHAAPLHL
PLVGQNCWPHMASGFSASMWLRVSEQDGDRNQGETPSFDALGNTSGALSLPEDGSPPAAQ
PHHGASQAGTRPAEDGLTHIMSMGSKALMLQMWADFSTGSLTFRICIDPNDEMKAGLLAQ
AESGEKLLNAGQWQHVGLTYTQQLEGKKNTHGRVVVWVCGIRKCEVSLVYSLPRKSSLSS
DSNKTFCMLGHCTQASGELGKQGRLWSLGTVLLFNGSRIGTEEALYLFTSGPDLTSIMPC
KYGKPAGIFTKFVTEDSLRSEHVRELFMKNKDVDTAALVESLAVVYAPSSPRDYTIYEPV
IRLKGQARTVVTQRPFSSKEVQSLSLEPSALSSLQPTETQGLQSVLHKIGGMGTFVFLFA
RTVELSDCEKTQALALRVLLSLTKFNQHRIHEMDCCHGYSMIHQVLIKSKCIVGYHVLKT
LLDGCCSRPILLLGDDEQFRLDPDSVAVVQDIRLLSDVLLDWKIWAKAECGVWETLLTAL
EILIRVHHPHQVFNIRQLLKAGVVHHFLLTWQVLQEHRDEHLTAIPQDVCLSFVRIIQEV
LGSPPDMDLLRLIYNFLLAVHPPTNTYVCHTPASFYFSLHLDGKLYREKVQSIMYLRHSS
SGGKSTSSSVVSLSPTVFNDAPHEGHLHAPSPEHGGDDQLLRPPSLAPSPYTSPLLTPRL
GHPNSSEAGESDRSSLAALQALGSTETLKKAGDEPLLSSCESAKTICDSKSDPKDAGQGA
LRTPSISVEDGSVGVAESEDRFDWATEETPRRPDSLKGIQSFQRSHSNLASLGLAFPAQN
GSLAISRWPSAAERGSMPEDWESYTYSPGYERAHSKTETNERSSTEDCLVLICCGLYDLL
RGILLLLPDLMLEEVMDKLIQPEALIVLVNHSSPLIQQGVMKLLDAYFSRAHKEQKEKFL
KNHGFSLLANQLYIHQGNQGLLECFLEMLFGHPVSLEEDLDLEEMENISPFRKRCIIPVL
GLIENSLYENSLAHSILCMLLQLVNACPKLADILLDHGLLYVLFNTLSTLNGMETGIPLN
DYKLLVCDIQQLLVAVTIHSCSSSGSQYFRIIEDLITLLGFMQTSKVGRTQEMAVALQFR
VLQSAVEFIKSTANQEPPTLSSSATAPSSPHYGIYQKRRSIAGRRRFSLAQSDSLLMRMR
SLASDELSQMMQRRMSQENPIRASEAEFVQRLQKLVVLAVNRLIYHDVSQDLFDLLNIPD
SPDQQPLTPELCEAPPESGPASVPHSPVPFTLPPASKTSFQKDILKLMMDGIKLSLSSGR
GPAPHHQWQKILWSCRDTFRVQIGRLLVHTLSPALPLSDRKEALEFVLDSRHLDILKESL
SPSLEHGTKLSLYLHEMLHDHKDSLTKEEQRAVDVFATSLKLCGHRCIPPNAAHKQDLLK
ALKEETFRYEAEEKTSKAAWEKKIVSTQRNLILRLDGKSKDISKIAADITQNVSLLQGME
RKKVIQHIKGLYKTDLSASRHWQELVQQLTHDRAVWYDSSSYPTSWQLDPTEGPNRERRR
LQRCYLTIPNKYLLKDRRKPDDPAKAALSFLFEDKTHSSFSSTVKDKATSEPIRFTRRCI
SVAPSRETAGELLLGKSGMYFVEDNAADAHDSQSLHGETEAPSFSWTYEEIKEVHKRWWQ
LRDNAVEIFLTNGRTLLLAFDNAKFRDDVYHNILTSDLPNLLEHGNITALTQLWSSGQIS
NFEYLTHLNKHAGRSFNDLMQYPVFPFILRDYTSETLDLQDAGIYRNLSKPIAVQSKEKE
DRYVDNYRYLEEEYRKGVREDDPMPPVQPYHYGSHYSNSGTVLHFLVRMPPFTKMFLAYQ
DQSFDIPDRTFHSMNTTWRLSSYESMTDVKELIPEFFYLPEFLVNREGAVDFGVRQNGER
VNHVNLPPWARNDPRLFVLIHRQALESEQVSQTLCQWIDLVFGLKQKGKAAVQAINVFHP
ATYFGMDVSAVEDPVQRRALETMITYGQTPRQLFNGSHVSRAASRVLMEGELPAAMGLLV
QLAFRETREPAKDVVCPSPLPWIRGLKWGEYVGSPCAPDPVVCFSQPHGERFGSLLALPT
RAVCGLSRKFCLMMIYSKEQGVRSMHSTDIQWSAILSWGYADNILRLKSKQSEPPINFIQ
CSQLHQVSSCAWVPDGCQLFTGSKCGVITAYSNRFTNTTPSEMEVESQVHLYGHTAEVTS
LFVCKPYSVLVSVSRDGTCILWDLNRLCYVQSLTGHKSPVTAVSASETTGDIATVCDSVG
GGSDLRLWTVNGDLIGHVHCREIICSVAFSNQPEGMSVNVIAGGLENGVVRLWSTWDLKP
VREITFSKSSKPIISLTYSCDGHHLYTANSEGTVMAWCRRDQQRMKLPMFYSFLSSYAAG
Download sequence
Identical sequences H3C352
ENSTNIP00000002671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]