SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002673 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002673
Domain Number 1 Region: 224-350
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-32
Family Cadherin 0.00028
Further Details:      
 
Domain Number 2 Region: 442-551
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-27
Family Cadherin 0.00043
Further Details:      
 
Domain Number 3 Region: 338-441
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-21
Family Cadherin 0.0025
Further Details:      
 
Domain Number 4 Region: 120-229
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-20
Family Cadherin 0.0021
Further Details:      
 
Domain Number 5 Region: 553-661
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-17
Family Cadherin 0.0019
Further Details:      
 
Domain Number 6 Region: 23-119
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000799
Family Cadherin 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002673   Gene: ENSTNIG00000002645   Transcript: ENSTNIT00000001937
Sequence length 943
Comment pep:known_by_projection chromosome:TETRAODON8:1:4865:33185:-1 gene:ENSTNIG00000002645 transcript:ENSTNIT00000001937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKEGNVWNYLVALLCFCGRSASQLSYSISEEGNKGTVVGNIAKDLNLNIHDIQNRNLRI
VSSHGKAFFGVNLPTGNLVVDERINREEVCPNVAHCSLRVQAVVSDPMDVYRIEVSVLDI
NDNSPEFIEQSLSLNVSESSLPAERYLLPVAEDADIGSNSVKGYSLSQNEHFSLDVQSGG
EHGLSAELVLRKALDREKQSFVSLVLTAVDGGKPVRTGSLRIRVNVLDVNDNVPTFSKSL
YKARVRENTAVGSVVIRLNATDLDEGQNGKIKYSFIKRGNSDPSSIFDLNSDTGEIKVKG
KLDYEETPAYEVRVQATDQATTPRSAHAKLLIEIIDENDNAPEISVTSLMTPVKEDAELG
TIVALVTISDKDGGRNGVAVCKVVGSVPFKLKSNYKNEYSLVVDGALDRENTCVYNVTVR
ATDEGDPPLSSVRVLTLHVSDVNDNPPVFMVPVINVYLRENSHPGSVIDTISAVDHDLDH
NAKIIYTLLDSSPRKIPISSMININSETGDIVSLQSFDYEELKTFQFQVQATDSGVPPLS
SNVSVNVLILDENDNNPAILAPYSEHGSVNSESIPYSAEAGYFVAKIRAVDLDSGYNALL
SYHLSEPKGNNLFRMGTSTGEIRTKRRMSDNDLKSHPLVVLVSDNGEPSLSATVSIEVVV
VESGADIQTPFRHNVPMKEESFSDLNLYLLIAIVAVSAIFLLSLITLIAVRCHRTDGGLG
RYGAPMITTHPDGSWSYSKSTQQYDVCFSSDTLKSDVVVFPAAFPPVDAELISINGGDTF
TRTQTLPTKEKPKMPSADWRYSASLRAGGVMQSSVHMEESSVMQGAQGVLVQNWPTASSA
ADAEGGEVSPPMGAGVDSNSWHFRYGPGGPGAPPQHLKPGEVPPEAFIIPGSPAIISIRQ
NQGGEDDKSDFITFGKKEEAKKKKKKKKEKKDKKDKGKDDGDE
Download sequence
Identical sequences H3C354
ENSTNIP00000002673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]