SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002690 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002690
Domain Number 1 Region: 3-95
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.24e-21
Family Spermadhesin, CUB domain 0.0026
Further Details:      
 
Domain Number 2 Region: 103-140
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000353
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 148-189
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000576
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 190-305
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000157
Family Spermadhesin, CUB domain 0.0098
Further Details:      
 
Domain Number 5 Region: 384-420
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 303-344
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 7 Region: 345-383
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000127
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002690   Gene: ENSTNIG00000000573   Transcript: ENSTNIT00000001740
Sequence length 509
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:92887049:92889237:1 gene:ENSTNIG00000000573 transcript:ENSTNIT00000001740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRRGVIYSPSWPLNSWHIQAEKGEVITISFWNFDLAESDGCSGDWLVLTPSWSLESRLCG
SVLPPPFISTAHHVWLYFSSQSNSSGQAQGFRLSYIRGQLGQSFCMNGEFLCDNGKCLPQ
IWWCNGYDECGDATDEKSCPAPSASSQPGFCPFGYLPCTEERSTRCLPSSLLCNGVPDCG
DGSDELGCTNATCRHHLGNFYGSFASQESSWPARSAVAELRCSWVLDTQDPRPIVLQMEL
WLGPDDSVLVYDSLEHRDEALIQAFWAYDNHRPVALESNSGRMSLLHRAHPHSSHHGFNA
TYQVQGYCFPHELPCGDNRACFSEHQRCDGYWHCPSGRDEEACVRCLAGEFPCDKSSLDC
YPASERCNNQRRCPDGADEANCYECQPGNFHCGKTCIFEMWRCDGHEDCSDGSDEKDCLE
ATPREVIAAALIGSLACSLMLVIALGCALRLCSLGSGEHSAYETQMSRREAELIRREAPP
SYGQLIAQGLIPDLDDYPAYNQSQNLPLK
Download sequence
Identical sequences H3C371
ENSTNIP00000002690 99883.ENSTNIP00000002690 ENSTNIP00000002690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]