SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002751 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002751
Domain Number 1 Region: 173-287
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000581
Family Growth factor receptor domain 0.024
Further Details:      
 
Domain Number 2 Region: 294-347
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000151
Family EGF-type module 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000002751
Domain Number - Region: 46-76
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000113
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 335-378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0645
Family EGF-type module 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002751   Gene: ENSTNIG00000008657   Transcript: ENSTNIT00000003816
Sequence length 494
Comment pep:known_by_projection chromosome:TETRAODON8:17:5749796:5759957:1 gene:ENSTNIG00000008657 transcript:ENSTNIT00000003816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGICVCLCVLLTHVLSLEPEDPISYTLLQCTDGYKYDRIEDLCRDIDECALIDDACKGG
MQCINHFGGYLCLPKNAYIFFDRDNDQQKVQNPAPPVDTIPRVVSSSETLYQSTRSIRCT
GGFTVDEQNFCRAKVASVSNSAYIRPLPANSPRCGGSLECSVRYSQFAPNVCDDIDECTT
GRHTCGPEQTCYNTRGSYTCNCPLGYQRNGDHCIDRNECSLTHYCMHACVNTQGSYYCDC
NIGYKLDSNNHTCVDVNECDVQSPCQHLCINLIGSFLCQCKQGYELATDAALLADIDECS
FPSYTCQYQCVNTPGSYYCECPEGYQLQGNRLCQDINECETGTHNCQDDEMCWNYYGGFR
CYPRNPCEAPYTKTTESRCICRSQTECQGLPPSIVYKYMSIQADRTAPADIFQIQATNIY
ANTHSTFRIKAGNAGGEFFLRRSGNASAMLVLTKPLTGPREYVVDLEMVTHHLVMNYRSS
SVLRLTIIVGPYAF
Download sequence
Identical sequences H3C3D2
ENSTNIP00000002751 99883.ENSTNIP00000002751 ENSTNIP00000011505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]