SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002757 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002757
Domain Number 1 Region: 165-280
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.75e-36
Family Ankyrin repeat 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002757   Gene: ENSTNIG00000014863   Transcript: ENSTNIT00000002907
Sequence length 415
Comment pep:known_by_projection chromosome:TETRAODON8:15_random:1774786:1779796:1 gene:ENSTNIG00000014863 transcript:ENSTNIT00000002907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKPGSDRDGAMVDKQAGKKCFNWAGHLSPAESGSEIKRDQSSTKSSFRSLVCFXPLPSS
SSLLCHVDDSDPGQSSETWGERLVAPCRIYADKDGPEKKKAKKEAGGKKSQANLLFGYPL
SERKQMALLMQMTANSPDSTPSHPSQTTPVQKKVPSSTSTRQKDKVNKRNERGETPLHMA
AIRGDVKQVKELISLGADVNVKDFAGWTPLHEACNLGYYDVAKVLIAAGAEVNTQGLDDD
TPLHDASSSGHKDIVKLLLRHGGNGFQANKRGERPVDVADTQELELLLKGEVPLSDQEDT
SSESEDPTSFNPSSVDDNMEDSDGEKDTESKAPAKASASVPGLDEYEFKDEEEEEDLSKA
LSDRHIYRKDLRQRDKDDKDKNHVVGKPSGKGDSISKSKKQKLSHCSSDTSGDEM
Download sequence
Identical sequences H3C3D8
ENSTNIP00000002757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]