SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002762 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002762
Domain Number 1 Region: 1435-1540
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.55e-23
Family Ankyrin repeat 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002762   Gene: ENSTNIG00000015003   Transcript: ENSTNIT00000003646
Sequence length 1712
Comment pep:known_by_projection chromosome:TETRAODON8:2:10658162:10680546:1 gene:ENSTNIG00000015003 transcript:ENSTNIT00000003646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TKPNPELRQGNHVTQNMVDARLTPLAAMGLDRSALMHNSLRLHSGVVYPGIRALSGEKSR
ENPSIPLAYNRDGLPELIYKPDASLESQKATNGYLGLYKGTPPSLHKPMLVPGAEGLGLE
RRVGPGEKASEMGLTSAGGSYLRLPWLNPYPEASMYPFIDTTKYAALNMYKASLLSQPSP
YLPQHLAYPSLCAAQGGSVNPAAAASAAERLYYMPPYPAPPISSPLVAPPMRIPTVTVAP
TSLVHCQDKGLSVAPPFPQQLHQPSPHTQHLQKSASSNSNTASNSANGTTGAIGSLSTDG
SRLSQPPPPPALIDNSLDLQRPVARLGQPPTSSTASISASSSATQSIPHPFFVSSMASEQ
SSPARPSPHKHRTRDGAPEQRSVGDERRSSRSPSKPSFERSVHQPQPTKDSAEKPLDLSG
RILEFGLPTNGFPVKMESIAQGARYGLPPSRELLKENPSLSPSSNPHSVVPERPEMISTL
HSSWVVPSQAPSSAKGSPPSVIKHKSLERVHPQQRSSSCPRIGEPPHNGSSTHSSLSSSR
ALSPKTTNDWVRHSPSRMEQTTVKGHHREGTEKSTHTIKRAETTSEGPSFKRPCLENGHP
PGHLYLPQNDTYLNHSLAYANRYLHYPVADGMTLHSMPITGKGPVYPHPGLLGSSSLYPT
HLTAKHPLSYHNLPAGSGGEYLTYNSQEMAHPLMHAPPDKMPDRGDVGLKTRGQERSRGV
IEDCGGQRDLNMGKDLGEATQFKLDKQMGTYAQSGSQCKGASSVPSREKIVCIDLVHSDT
DMESTPAGSKQLSAETGGKVNQKECTNQNLTEPKHHLSHPYSAHQGQSPTVKPNHPDRPT
DAPTGKARSLPASSSEAGSAGLTSTLSPTSPGLSAQVEEIPEEPICSPEPEDPDQSTLRC
ARTSGERSSEDGSQSSSKNCRRSSLAKRIANSSGFVGDRFKCVTTELYADSSKLGREQRA
LQMEVISREASNISQPATNWERAMMRFSELELKEKEGGGVCVTASAAAAAGRELADTQHG
EQALEHSQYSSRQGETEALQMNAWKGAHANNRGAHTLAYRSGSVPFGAVSASRGPFQPAA
AVSSELVQHSSRVQSAVLERSRLVSDRSACGEGKTEEGGENLRLHKQGADRCANNFAFRK
LVSHCLDAFREPHQYKPVDAQSACLALVFQRRELWAYRTRAEIRAPARQRQTCRRGSHAV
LQAVPPHTRAQGSILEREIRGRRERGVCESKKARVWREAGLWWHAQSQRGAAYHNTLPVS
LPNTCSHSRSQADTPFLPSSSPPSIHSAQKRERGWKSEINTWTGEPAGISIEIHTPSKGH
PTGSRTRPTGSGPVLQRFTRPLTVSALLTAADSPPVWWKQTSLTAGRPTVAVQDQRRGFR
LRRECFSASVKSPCSVSILPCSELSRRNWLPQRHPGLGITHALTHSHTHTLLPALNLACK
EVVLYCLENRVCDVNHRDYAGYCALHEACARGWLTIVQHLLDYGADINCSAQDGTRPIHD
AVENDHLDVVRILLSYGADPTLATYSGRGLLKMTHSETMEHFLTDYFADLQGRSDDDPGL
YWEFYGSSVCESSEEGGIYDVLADPPGPFEFEFSDRPLLPCYNIQVSLSQGPRNWLLLSD
VLRRLRMSARSFRQAFPHMEVVTVAEAEFYRQASLSQLFSCPEELEGFHPDSKDLLDLVE
DSTELATLLGSTLECLDDHWDHPADALKDRIK
Download sequence
Identical sequences H3C3E3
99883.ENSTNIP00000002762 ENSTNIP00000002762 ENSTNIP00000002762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]