SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002767 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002767
Domain Number 1 Region: 138-390
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.4e-56
Family Ankyrin repeat 0.00015
Further Details:      
 
Domain Number 2 Region: 424-739
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.33e-40
Family Patatin 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002767   Gene: ENSTNIG00000018843   Transcript: ENSTNIT00000003865
Sequence length 752
Comment pep:known_by_projection chromosome:TETRAODON8:18:10127832:10133993:-1 gene:ENSTNIG00000018843 transcript:ENSTNIT00000003865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFLGRLLDTVSSNLFANPYRVRDVPLSDYAGGGKIKLREEGRMVLYKNNQCRSWDCLLM
CPEMPMSTLRLFQVASEEDAMNWFPHYALTLQPFYEMLPLKAETTQPIVDCIRSHPDWSS
AHVAIDTGLRECLKHNYVQSQINSRDAAGQTPLHLACERGDPVCVKELLEESQAQTDIKD
RSGQTPMHMAAKHDSPAVIQVMCSRMCSGVNELNNSGETPLHVACRLGRVESVKALLAGG
AKCDIIGGAGYPIHSAMKYSEKCCVEEVLKADSGQLHAEDSAYGGTPLHWAKTAEMCRVL
LEHGCEINYLSKTGESPLHIMTKKGRFEAAMVLLTHGANANLKGQDGNTALHLAMKLDHI
ELIKALIVFGADVEIHNDLGETPGLIAARTSKGFEDIIYMGAAVAAMSRGSSQVDGCKMQ
KNRMDRLLCLDGGGIKGLVLIQMLIALEKEAGRPTRELFDWVAGTSTGGILALAIIHGKS
MEYLRCLYFRMKEQVFKGSRPYESAPLEEFLKKEFGENTKMTDIRYPRVMVTSVLADRHP
GELHIFRNYDPPSVHREAPYATTATFKPLTIPQEQLVWRAARSSGAPTYFRPMGRFLDGG
LLANNPTLDAMSEIHQYNKALKAEGREKETKKLGVVVSLGTGKPPQVAVSSVDVFRPSNP
LELAKSFVGAKELGKMLVDCCTDSDGCAVDRATAWCEMIDTVYYRLSPQLSQEVLLDEVS
DAALVDMMWETQMYLYEKRESLQSLAKLLLNN
Download sequence
Identical sequences H3C3E8
ENSTNIP00000002767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]