SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002782 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002782
Domain Number 1 Region: 11-148
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.16e-29
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002782   Gene: ENSTNIG00000000820   Transcript: ENSTNIT00000002187
Sequence length 154
Comment pep:novel chromosome:TETRAODON8:Un_random:67532621:67533507:1 gene:ENSTNIG00000000820 transcript:ENSTNIT00000002187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALYDPCSLLQAEQLEYKCDCGASESWQRRSFSTLPNVLIVHLQRFEVTPFFTVEKTHEA
VSLSTELLLSTNQSAEKTKYSLKSVVNHFGSGVKSGHYVCDGVYRNASPENGNTCWLTYD
DDSVKETSVGHVCQQRQTTAYLLFYQKQRKQESS
Download sequence
Identical sequences H3C3G3
99883.ENSTNIP00000002782 ENSTNIP00000002782 ENSTNIP00000002782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]