SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002790 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002790
Domain Number 1 Region: 212-445
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.79e-76
Family Eukaryotic proteases 0.00000344
Further Details:      
 
Domain Number 2 Region: 28-91
Classification Level Classification E-value
Superfamily GLA-domain 4.37e-24
Family GLA-domain 0.00023
Further Details:      
 
Domain Number 3 Region: 82-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000187
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 4 Region: 117-162
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000431
Family EGF-type module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002790   Gene: ENSTNIG00000006589   Transcript: ENSTNIT00000003324
Sequence length 445
Comment pep:known_by_projection chromosome:TETRAODON8:3:1188731:1192162:1 gene:ENSTNIG00000006589 transcript:ENSTNIT00000003324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RQSGLPRPGPQAFLDKNNAAQVLSRRRRANSFLEELKQGNMERECNEERCSLEEAREIFE
DADKTNDFWAVYIDGDACKSIPCANNGRCKDGIGTYTCFCPTGYQGFNCEIVIPQLCEKE
NGGCEHFCHVVRGNVQCSCAGGYSLASDDKSCHSSEKFRCGGIVQENTRTVFLYDRQNTT
TDGQNITSLINSTESFSKVSSDNQKEERIISEMAQKTRIVNGENCPPGECPWQAVLMNED
HRWFCGGTILNQYIILTAAHCMNETNYFYVKLGEFDMLVDEGNEAIHEVETILAHNKYLP
DTYHNDIALIKLVTPITYSKFILPACIPEQEFAESVLMQQPDGMISGFGRFRENRPTSNL
QRLTIPYVDRRTCIESTSLRISTRMFCAGYDDIAKDACQGDSGGPHVTSYRDTYFVTGIV
SWGEGCARKGKYGVYTQVSKYIGWI
Download sequence
Identical sequences H3C3H1
ENSTNIP00000002790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]