SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002792 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002792
Domain Number 1 Region: 180-278
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.25e-22
Family Synaptotagmin-like (S variant) 0.024
Further Details:      
 
Domain Number 2 Region: 20-125
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.74e-20
Family Synaptotagmin-like (S variant) 0.022
Further Details:      
 
Domain Number 3 Region: 323-504
Classification Level Classification E-value
Superfamily vWA-like 6.95e-18
Family Integrin A (or I) domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002792   Gene: ENSTNIG00000013729   Transcript: ENSTNIT00000001360
Sequence length 588
Comment pep:known_by_projection chromosome:TETRAODON8:13:12219918:12247375:1 gene:ENSTNIG00000013729 transcript:ENSTNIT00000001360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMNMAFIGDADPFTAAIPATKVELTVSCRNLLDRDTFSKSDPICVLYTQGIANREWREFG
RTEVIDNTLNPDFVRKFILDYFFEERQNLRFDLYDLDCKSDNLSKHDFLGQVFCTLGEIV
GSLGGRLEKPLIIHVFGTYVRGNVFARSSRNGIPGKKCGTIIVRAEELSNCRESVMLQFC
GNKLDKKDFFGKSDPFLVFYRSNEDGSYTICHKTEVVKNTLDPVWQAFKIPVRALCNGDY
DRSIKVEVYDWDRDGGHDFIGEFSTSYREMSRSQSQFHIYEQEQNLLKVQESEKYQNSGT
VTLLSCLVDTELSFLDYIRGGTQINFTVAIDFTASNGNPSQPTSLHYMSPYQMNDYAMAL
RAVGEIIQDYDSDKMFPALGFGAKLPPDGRVSHEFPLNGNPQNPYCSGIEGVMEAYYQSL
KSVRLYGPTHFSPVINHVARYASAVTDGSQYFILLIISDGVITDMAQTKESIVNAASLPM
SIIIVGVGPAEFDEMVELDGDEERISSQGRYAERDIVQFVPFRDYIDRRGNHILSMARLA
KEVLAEIPDQFLSYMRTRGIKPGPLPPPYTPCPPPALHPLLTRRVSRI
Download sequence
Identical sequences H3C3H3
99883.ENSTNIP00000002792 ENSTNIP00000002792 ENSTNIP00000003175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]