SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002808 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002808
Domain Number 1 Region: 342-514
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.8e-50
Family SPRY domain 0.000043
Further Details:      
 
Domain Number 2 Region: 13-81
Classification Level Classification E-value
Superfamily RING/U-box 9.66e-18
Family RING finger domain, C3HC4 0.0056
Further Details:      
 
Domain Number 3 Region: 134-193
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000058
Family B-box zinc-binding domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002808   Gene: ENSTNIG00000006492   Transcript: ENSTNIT00000001219
Sequence length 522
Comment pep:known_by_projection chromosome:TETRAODON8:3:15290613:15298728:-1 gene:ENSTNIG00000006492 transcript:ENSTNIT00000001219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PMAEAGALDLFSEQELTCSICLDLFDEPVSTPCGHNFCQACIGGYWASSAVCTCPLCKHQ
FDERPQLSVNKVFALIAHKFKETRAAAGEEVVWCDVCTGVKRPATSSCLTCTASYCAEHE
QPHRSTPFYAKHPLMDPREALRGRTCDLHRRLLEVYCRICQRCICAICVLEEHRTHKTVS
VQTERLGKQEMVNRIKDREMRVSQLKKKMEAAKSYADAERAELGHLLDEVSRSLDRIRSQ
VLGDIDSQLDGVMSKGEGLVRRLEAELSLLSDRRATLEVQAINQDHIGFLQSYQEATAPL
EENQQSELTAAESVLSLRGSSANLRRTDVKKNKQVTDVKKNKQVTEDVTLNPVTAYPFLI
LSDDRKQVKRGEKLQFFRNSQQRFDVWSCVMAKEGFSSGRHYWEVFVGDSKDWKVGVVTE
AAQRKGLFDMTPASGYYALWWSGSHLRALTTPPLAKVKAPLKLRQVGVFLDMDEGQVTFY
NIKSGSEIYSFARGREFTDRMFPLFGTGDKDVPLVLMTTQHH
Download sequence
Identical sequences H3C3I9
ENSTNIP00000002808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]