SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002830 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002830
Domain Number 1 Region: 710-998
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.91e-74
Family Protein kinases, catalytic subunit 0.000000000941
Further Details:      
 
Domain Number 2 Region: 352-524
Classification Level Classification E-value
Superfamily L domain-like 8.22e-42
Family L domain 0.0000137
Further Details:      
 
Domain Number 3 Region: 52-208
Classification Level Classification E-value
Superfamily L domain-like 4.25e-37
Family L domain 0.0000516
Further Details:      
 
Domain Number 4 Region: 510-636
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-19
Family Growth factor receptor domain 0.00000768
Further Details:      
 
Domain Number 5 Region: 189-338
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000602
Family Growth factor receptor domain 0.00000739
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002830   Gene: ENSTNIG00000018932   Transcript: ENSTNIT00000001827
Sequence length 1031
Comment pep:known_by_projection chromosome:TETRAODON8:2:7869606:7879994:1 gene:ENSTNIG00000018932 transcript:ENSTNIT00000001827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVRTRLRCGYTLTFSLLTVSSGSAQSACMGTDMKLSLPSSLENHHEMLRLLYTGCQVVH
GNLEITHLHGTPDLSFLQGIVEVQGYVLVAHVSVSLLPLDNLRIIRGSQLYNSSYALAVL
DNTLDGRGLRTLHLRSLTEILFGSVYVWGNPQLCFPDPQSINWRDILDQQNTDTRHRLQP
RAQNCAGPNCSSQCLTSCWGEAAQDCQTFKVTRSNCASGCQRCKGFLPNDCCHKQCAAGC
TGPKDSDCLACRHFNDSGVCKENCPPPTTYDPATFQSKPNPDRKFSFGATCVKTCPYNYL
AMDVACTLNYPKPNPKDVVPQPCGNDTQKCEKCEGDCPKGMDDHGAVDSSGSTMVTAANV
GQFNKCTKIFGSLAFHSQSFSRDPVTNASGLSPEQLSVFRNLEEITGYLYIEAWPQEWMN
LNVFDNLKVIRGRMLYKGVFSLAIQNLQITSLGLRSLRSISGGLVLLHNNSQLCYTSSLP
WESIVHPTQGPHRIVSKNLDPQICEKQGHVCHRLCKGGCWGPGPGQCASCETFQRGTECV
EHCDIYQGSVREYASESLCVACHPECQPLNGSASCHGPGAEHCVECRKFQDGDFCVDHCP
SGVKEDHQTVWKYSNATGHCLPCNTNCTLSCTVKDERGCPVDTRAGLGTTIAAAVGGVVL
FFILLGLLFFYLRRQKKLKRKETMARILQEHELVEPLAPSGASPNQAQMRILKETELKKL
KVLGAGAFGTVYKGVWAPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVASPYVC
RLLGICLTSTVQVTQLMSYGCLLEYVRKNKDHIGSQLLLNWCVQIAKGMSYLEEVRLVHR
DLAARNVLVKNPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILQRKFTHQSD
VWSYGVTVWELMTFGAKPYDMIPARDIPEVLEGGERLPQPPICTIDVYMIMVKCWMIDPD
YRPRFKDLVKEFTTMARDPPRYVVIQNEEQMGTPSPVDNQFFRLLVEEEGNNLRELLDAE
EYLVPQPNHFP
Download sequence
Identical sequences H3C3L1
ENSTNIP00000002830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]